![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC8549_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10076.5 Da PI: 9.7477 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 59.1 | 1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +l+ +v+++G g W+t + + g++R++k+c++rw +yl
RrC8549_p1 14 KGAWTQEEDHKLISYVQRHGEGGWRTLPDKAGLKRCGKSCRLRWANYL 61
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.0E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 22.91 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.6E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.6E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.8E-22 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.43E-8 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 6.9E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MVRTPCCRAE GLKKGAWTQE EDHKLISYVQ RHGEGGWRTL PDKAGLKRCG KSCRLRWANY 60 LRPDIKRGEF SQAEEDSIIS LHAIHGNK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 6e-14 | 12 | 88 | 5 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in glucosinolates biosynthesis. {ECO:0000269|PubMed:23580754, ECO:0000269|PubMed:23943862}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ670120 | 1e-116 | KJ670120.1 Brassica napus MYB transcription factor 122 (MYB122.1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009106064.1 | 3e-57 | PREDICTED: transcription factor MYB122-like | ||||
| Swissprot | Q9C9C8 | 8e-58 | MY122_ARATH; Transcription factor MYB122 | ||||
| TrEMBL | A0A3P6BA85 | 7e-56 | A0A3P6BA85_BRACM; Uncharacterized protein | ||||
| STRING | Bo6g118350.1 | 2e-56 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G74080.1 | 4e-60 | myb domain protein 122 | ||||




