PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC8577_p2

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

Protein Properties

Length: 202aa MW: 22681.2 Da PI: 8.8898

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC8577_p2	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	34.6	3.3e-11	85	128	53	98
EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 53 rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 +++++r++lt+GW+ Fv+a++L +gD+v+F ++++ +l+++++ RrC8577_p2 85 TRQPKRHLLTTGWSVFVSAKRLVTGDSVIFI--RNERNQLLLGIRH 128 688999*************************..4577777998876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101936	1.44E-16	62	157	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF02362	2.6E-8	85	128	IPR003340	B3 DNA binding domain
Gene3D	G3DSA:2.40.330.10	1.5E-14	86	143	IPR015300	DNA-binding pseudobarrel domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 202 aa Download sequence Send to blast
MELCKQVAAT TNKEVEGHIP NYPTLPPQLI CQLHNADLET DEVYAQMVLQ PLTQEQKDTF 60 VPIELGIPSK QPSNYFCKTL TASDTRQPKR HLLTTGWSVF VSAKRLVTGD SVIFIRNERN 120 QLLLGIRHAT RPQTIVPSSM LSSDSMHIGL LAAAAHAAAT NSCFTVFYHP RLKKNSFLPP 180 SQYLKMTTLT NVLFYAHQVY LI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4ldu_A	4e-52	5	185	82	316	Auxin response factor 5
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Seems to act as transcriptional activator. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Regulates both stamen and gynoecium maturation. Promotes jasmonic acid production. Partially redundant with ARF6. Involved in fruit initiation. Acts as an inhibitor to stop further carpel development in the absence of fertilization and the generation of signals required to initiate fruit and seed development. {ECO:0000269\|PubMed:12036261, ECO:0000269\|PubMed:16107481, ECO:0000269\|PubMed:16829592}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by miR167. {ECO:0000269\|PubMed:17021043}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JN979471	1e-113	JN979471.1 Brassica rapa subsp. pekinensis auxin response factor 8-1 (ARF8-1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018446176.1	4e-96	PREDICTED: auxin response factor 8-like
Swissprot	Q9FGV1	3e-90	ARFH_ARATH; Auxin response factor 8
TrEMBL	A0A3P6GTT3	6e-95	A0A3P6GTT3_BRAOL; Auxin response factor
STRING	Bo6g099440.1	2e-95	(Brassica oleracea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G37020.2	5e-92	auxin response factor 8

Publications ? help Back to Top
Liu N, et al. Down-regulation of AUXIN RESPONSE FACTORS 6 and 8 by microRNA 167 leads to floral development defects and female sterility in tomato. J. Exp. Bot., 2014. 65(9): p. 2507-20 [PMID:24723401] Minato N, et al. The phytoplasmal virulence factor TENGU causes plant sterility by downregulating of the jasmonic acid and auxin pathways. Sci Rep, 2014. 4: p. 7399 [PMID:25492247] Ortega-Amaro MA, et al. Overexpression of AtGRDP2, a novel glycine-rich domain protein, accelerates plant growth and improves stress tolerance. Front Plant Sci, 2014. 5: p. 782 [PMID:25653657] Wang Y, et al. MicroRNA167-Directed Regulation of the Auxin Response Factors GmARF8a and GmARF8b Is Required for Soybean Nodulation and Lateral Root Development. Plant Physiol., 2015. 168(3): p. 984-99 [PMID:25941314] Barik S, et al. Coevolution Pattern and Functional Conservation or Divergence of miR167s and their targets across Diverse Plant Species. Sci Rep, 2015. 5: p. 14611 [PMID:26459056] Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants. Plant Physiol. Biochem., 2016. 104: p. 146-54 [PMID:27031426] Mlotshwa S,Pruss GJ,MacArthur JL,Reed JW,Vance V Developmental Defects Mediated by the P1/HC-Pro Potyviral Silencing Suppressor Are Not Due to Misregulation of AUXIN RESPONSE FACTOR 8. Plant Physiol., 2016. 172(3): p. 1853-1861 [PMID:27688620] Wójcikowska B,Gaj MD Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis. Plant Cell Rep., 2017. 36(6): p. 843-858 [PMID:28255787] Zhang GZ, et al. Ectopic expression of UGT84A2 delayed flowering by indole-3-butyric acid-mediated transcriptional repression of ARF6 and ARF8 genes in Arabidopsis. Plant Cell Rep., 2017. 36(12): p. 1995-2006 [PMID:29027578] Zheng K, et al. Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis. Front Plant Sci, 2017. 8: p. 1813 [PMID:29114256] Liu Z, et al. ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis. Plant Cell Physiol., 2018. 59(1): p. 179-189 [PMID:29145642] Ghelli R, et al. A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis. Plant Cell, 2018. 30(3): p. 620-637 [PMID:29514943]