![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | RrC9741_p1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 135aa MW: 15390.4 Da PI: 9.6311 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 108.3 | 6.1e-34 | 52 | 108 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq+Rakle+++k+ ksrkpylheSRh hA+rRpRg+gGrF
RrC9741_p1 52 EEPVFVNAKQYHGILRRRQSRAKLESQNKV-VKSRKPYLHESRHLHAIRRPRGCGGRF 108
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 5.2E-38 | 50 | 111 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 38.642 | 51 | 111 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.0E-28 | 53 | 108 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 1.7E-24 | 54 | 76 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 56 | 76 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 1.7E-24 | 85 | 108 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 135 aa Download sequence Send to blast |
APGHYPYPDL YYRSICAPNP QVFPQRPYET GVHAHLMGVQ QQCVPLPSDA VEEPVFVNAK 60 QYHGILRRRQ SRAKLESQNK VVKSRKPYLH ESRHLHAIRR PRGCGGRFLN AKKEEEHHED 120 SHVEEKSMAA SGGTS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 4e-22 | 51 | 118 | 1 | 68 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT004274 | 1e-83 | BT004274.1 Arabidopsis thaliana clone RAFL15-46-O22 (R50095) putative transcription factor (At1g30500) mRNA, complete cds. | |||
| GenBank | BT005561 | 1e-83 | BT005561.1 Arabidopsis thaliana clone U50095 putative transcription factor (At1g30500) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018470276.1 | 2e-91 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
| Refseq | XP_018470284.1 | 2e-91 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
| Swissprot | Q84JP1 | 1e-73 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | A0A3P5Y2L2 | 5e-88 | A0A3P5Y2L2_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4EUB3 | 5e-88 | M4EUB3_BRARP; Uncharacterized protein | ||||
| STRING | Bra032395.1-P | 9e-89 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4168 | 27 | 56 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 6e-65 | nuclear factor Y, subunit A7 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




