![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_00046.1_g00029.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 116aa MW: 12991.7 Da PI: 9.6581 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 50 | 9.6e-16 | 19 | 64 | 2 | 48 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAl 48
ep++VNaKQy++I++RR++ akle+++kl +k+rk e h + +
Rsa1.0_00046.1_g00029.1 19 EPVFVNAKQYHAIMRRREQCAKLEAQNKL-IKGRKAAAKEQEHDKSV 64
8****************************.******99998887766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 4.4E-11 | 16 | 75 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 16.3 | 17 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.5E-10 | 19 | 64 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MVGMVPGRVP LPVEITEAEP VFVNAKQYHA IMRRREQCAK LEAQNKLIKG RKAAAKEQEH 60 DKSVQQANMS RFKAYMLQHN KDRGLTTSGS DITSVSDGAA DIFGHTEFQR FSNNSD |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_00046.1_g00029.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189507 | 8e-63 | AC189507.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB088E11, complete sequence. | |||
| GenBank | AC189607 | 8e-63 | AC189607.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH031P22, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013590425.1 | 8e-56 | PREDICTED: nuclear transcription factor Y subunit A-3-like | ||||
| Swissprot | Q93ZH2 | 1e-47 | NFYA3_ARATH; Nuclear transcription factor Y subunit A-3 | ||||
| TrEMBL | A0A0D3D078 | 2e-52 | A0A0D3D078_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6GDQ9 | 6e-53 | A0A3P6GDQ9_BRAOL; Uncharacterized protein | ||||
| STRING | Bo6g116240.1 | 3e-53 | (Brassica oleracea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G72830.1 | 5e-50 | nuclear factor Y, subunit A3 | ||||




