![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_00131.1_g00058.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 70aa MW: 7761.56 Da PI: 11.1191 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 135.5 | 1.3e-42 | 2 | 70 | 2 | 70 |
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+++k+e+kGlnPGliv+lv+ggll++flvgn++ly+yaqknlPPrkkkP+skkk+k+eklk+Gv+vPGe
Rsa1.0_00131.1_g00058.1 2 KQGKIESKGLNPGLIVILVIGGLLVTFLVGNFVLYTYAQKNLPPRKKKPLSKKKMKKEKLKKGVQVPGE 70
5789****************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 1.0E-4 | 5 | 40 | No hit | No description |
| Pfam | PF04689 | 4.7E-38 | 6 | 70 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MKQGKIESKG LNPGLIVILV IGGLLVTFLV GNFVLYTYAQ KNLPPRKKKP LSKKKMKKEK 60 LKKGVQVPGE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_00131.1_g00058.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC016661 | 3e-58 | AC016661.7 Arabidopsis thaliana chromosome 3 BAC F11F8 genomic sequence, complete sequence. | |||
| GenBank | CP002686 | 3e-58 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104121.2 | 3e-23 | DNA-binding protein S1FA | ||||
| Refseq | XP_024026346.1 | 3e-23 | DNA-binding protein S1FA | ||||
| Swissprot | Q42337 | 2e-17 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | A0A1J3J4X3 | 8e-23 | A0A1J3J4X3_NOCCA; DNA-binding protein S1FA2 | ||||
| STRING | A0A087H8A9 | 2e-23 | (Arabis alpina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2823 | 27 | 69 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G09735.1 | 3e-11 | S1FA-like DNA-binding protein | ||||




