![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_00278.1_g00003.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 84aa MW: 9458.77 Da PI: 4.3441 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 66.2 | 9.3e-21 | 6 | 54 | 1 | 50 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
lppGfrFhPtdeelv +yL +kv+g+++el e+i+evd+yk+ePwdLp +
Rsa1.0_00278.1_g00003.1 6 LPPGFRFHPTDEELVAYYLDRKVNGRTIEL-EIIPEVDLYKCEPWDLPGR 54
79****************************.99**************953 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.96E-21 | 3 | 55 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 20.479 | 6 | 84 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.9E-9 | 7 | 49 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MAPMSLPPGF RFHPTDEELV AYYLDRKVNG RTIELEIIPE VDLYKCEPWD LPGRFELPPV 60 SSRTDGVADI PVNGVEGRVC RGET |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 8e-17 | 2 | 54 | 11 | 63 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_00278.1_g00003.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009104136.1 | 1e-32 | PREDICTED: NAC domain-containing protein 86-like | ||||
| Swissprot | Q9FFI5 | 4e-30 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
| TrEMBL | A0A397YME5 | 3e-31 | A0A397YME5_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6BE60 | 3e-31 | A0A3P6BE60_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4CGK2 | 3e-31 | M4CGK2_BRARP; Uncharacterized protein | ||||
| STRING | Bra003335.1-P | 5e-32 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7967 | 13 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G54330.1 | 1e-34 | NAC domain containing protein 20 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




