![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_00346.1_g00015.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 138aa MW: 15911.9 Da PI: 6.5427 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 28.7 | 2.2e-09 | 81 | 115 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55
k +yp++ ++ LA+ +gL+++q+ +WF N+R ++
Rsa1.0_00346.1_g00015.1 81 KWPYPTEGDKIALADATGLDQKQINNWFINQRKRH 115
569*****************************985 PP
| |||||||
| 2 | ELK | 31.7 | 3.4e-11 | 35 | 56 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
+LK++LlrK++++++sLk EFs
Rsa1.0_00346.1_g00015.1 35 DLKDRLLRKFGSRISSLKLEFS 56
69*******************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51213 | 9.83 | 35 | 55 | IPR005539 | ELK domain |
| SMART | SM01188 | 6.3E-5 | 35 | 56 | IPR005539 | ELK domain |
| Pfam | PF03789 | 8.0E-8 | 35 | 56 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 12.374 | 55 | 118 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 2.4E-20 | 56 | 132 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 1.0E-12 | 57 | 122 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-28 | 60 | 119 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 3.02E-11 | 67 | 119 | No hit | No description |
| Pfam | PF05920 | 7.0E-18 | 75 | 114 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 93 | 116 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MSGSSLEDGA VSSDEELNGG DEILQDGKQI CEDRDLKDRL LRKFGSRISS LKLEFSKKKK 60 KGKLPKEARQ ALLDWWNVHY KWPYPTEGDK IALADATGLD QKQINNWFIN QRKRHWKPSE 120 NMPFAMMDDS SGSFFTEE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_00346.1_g00015.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB072361 | 1e-104 | AB072361.1 Arabidopsis thaliana KNAT6S mRNA for homeodomain transcription factor KNAT6, complete cds. | |||
| GenBank | AB072362 | 1e-104 | AB072362.1 Arabidopsis thaliana KNAT6L mRNA for homeodomain transcription factor KNAT6, complete cds. | |||
| GenBank | BT002930 | 1e-104 | BT002930.1 Arabidopsis thaliana clone RAFL14-89-I21 (R20256) putative homeodomain transcription factor KNAT6 (At1g23380) mRNA, complete cds. | |||
| GenBank | BT004370 | 1e-104 | BT004370.1 Arabidopsis thaliana clone U20256 putative homeodomain transcription factor KNAT6 (At1g23380) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009115534.1 | 4e-93 | PREDICTED: homeobox protein knotted-1-like 6 isoform X1 | ||||
| Refseq | XP_013717242.1 | 4e-93 | homeobox protein knotted-1-like 6 isoform X1 | ||||
| Refseq | XP_018442762.1 | 3e-93 | PREDICTED: homeobox protein knotted-1-like 6 isoform X1 | ||||
| Refseq | XP_018442768.1 | 3e-93 | PREDICTED: homeobox protein knotted-1-like 6 isoform X2 | ||||
| Swissprot | Q84JS6 | 2e-81 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
| TrEMBL | A0A078JRS2 | 6e-93 | A0A078JRS2_BRANA; BnaAnng30720D protein | ||||
| STRING | Bra024591.1-P | 1e-92 | (Brassica rapa) | ||||
| STRING | Bo5g039530.1 | 4e-93 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM835 | 27 | 85 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G23380.1 | 5e-74 | KNOTTED1-like homeobox gene 6 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




