![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_00387.1_g00041.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 138aa MW: 16141.8 Da PI: 10.3751 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 49.4 | 1.1e-15 | 14 | 59 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
rg W Ed l ++v+ +G+ +W+ Ia++m+ gRt+k+c++rw++
Rsa1.0_00387.1_g00041.1 14 RGHWRISEDSHLMELVAVYGPQNWNHIAEKMQ-GRTGKSCRLRWFNQ 59
789999**************************.***********996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 20.835 | 9 | 64 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.0E-9 | 13 | 62 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.3E-15 | 14 | 59 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.83E-22 | 14 | 104 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-24 | 15 | 67 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.40E-9 | 17 | 58 | No hit | No description |
| PROSITE profile | PS50090 | 3.961 | 61 | 105 | IPR017877 | Myb-like domain |
| SMART | SM00717 | 7.1 | 65 | 114 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 0.0043 | 68 | 100 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 8.9E-10 | 68 | 104 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MNQKEEACFR VCSRGHWRIS EDSHLMELVA VYGPQNWNHI AEKMQGRTGK SCRLRWFNQL 60 DPRINKRAFN LEEEERLLAA HRGFGHKCAM IAKLFNGRTD DAFKEPQAYV LMARKLRKLI 120 KNLSTPAIII KVPVSDRY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 7e-23 | 14 | 104 | 4 | 94 | MYB PROTO-ONCOGENE PROTEIN |
| 1h88_C | 3e-22 | 14 | 104 | 58 | 148 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 3e-22 | 14 | 104 | 58 | 148 | MYB PROTO-ONCOGENE PROTEIN |
| 1h8a_C | 2e-22 | 13 | 104 | 26 | 117 | MYB TRANSFORMING PROTEIN |
| 1mse_C | 7e-23 | 14 | 104 | 4 | 94 | C-Myb DNA-Binding Domain |
| 1msf_C | 7e-23 | 14 | 104 | 4 | 94 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_00387.1_g00041.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018478826.1 | 6e-96 | PREDICTED: transcription factor MYB44-like | ||||
| Swissprot | Q9SEZ4 | 2e-49 | MY105_ARATH; Transcription factor MYB105 | ||||
| TrEMBL | A0A087GV70 | 3e-60 | A0A087GV70_ARAAL; Uncharacterized protein | ||||
| TrEMBL | R0FTE6 | 5e-60 | R0FTE6_9BRAS; Uncharacterized protein | ||||
| STRING | A0A087GV70 | 6e-61 | (Arabis alpina) | ||||
| STRING | XP_006292843.1 | 8e-61 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6300 | 18 | 46 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G29020.1 | 3e-51 | myb domain protein 110 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




