![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_00690.1_g00015.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 132aa MW: 15075 Da PI: 5.7214 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 161.2 | 1.5e-50 | 2 | 94 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89
++dr+lPianv+r+mk++lP+nakisk+ak+tvqec++efisfvt+easdkc+re+rkt+ngdd++wal+tlG+++y++++ yl+k
Rsa1.0_00690.1_g00015.1 2 ADEDRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENRKTVNGDDIWWALSTLGLDNYADAVGRYLHK 89
589************************************************************************************* PP
NF-YB 90 yrele 94
yre
Rsa1.0_00690.1_g00015.1 90 YREKR 94
**964 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 5.1E-47 | 3 | 110 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.84E-37 | 4 | 112 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.8E-26 | 7 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-16 | 35 | 53 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 38 | 54 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.7E-16 | 54 | 72 | No hit | No description |
| PRINTS | PR00615 | 1.7E-16 | 73 | 91 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 132 aa Download sequence Send to blast |
MADEDRLLPI ANVGRLMKQI LPSNAKISKE AKQTVQECAT EFISFVTCEA SDKCHRENRK 60 TVNGDDIWWA LSTLGLDNYA DAVGRYLHKY REKRERAENN KSSNDSGNER EPNLLLVEIN 120 LCDLNHVLLK DL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 6e-40 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 6e-40 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00133 | DAP | Transfer from AT1G09030 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_00690.1_g00015.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB493443 | 1e-111 | AB493443.1 Arabidopsis thaliana At1g09030 gene for hypothetical protein, partial cds, clone: RAAt1g09030. | |||
| GenBank | BT029363 | 1e-111 | BT029363.1 Arabidopsis thaliana At1g09030 mRNA, complete cds. | |||
| GenBank | CP002684 | 1e-111 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| GenBank | F7G19 | 1e-111 | AC000106.1 Sequence of BAC F7G19 from Arabidopsis thaliana chromosome 1, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009148158.1 | 1e-78 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
| Refseq | XP_013646457.1 | 1e-78 | nuclear transcription factor Y subunit B-4-like | ||||
| Refseq | XP_013710807.1 | 1e-78 | nuclear transcription factor Y subunit B-4-like | ||||
| Refseq | XP_018493457.1 | 1e-78 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O04027 | 1e-73 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A397YUN0 | 3e-77 | A0A397YUN0_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4DPZ4 | 3e-77 | M4DPZ4_BRARP; Uncharacterized protein | ||||
| STRING | Bra018585.1-P | 4e-78 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 5e-76 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




