PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01970.1_g00004.1
Organism
Raphanus sativus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 148aa    MW: 16715.9 Da    PI: 4.9806
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01970.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.69.5e-122276559
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
                             ++ +r+ +NRe+ArrsR +K++ ++ L+  v +L+++N +    ++  ++++ ++
  Rsa1.0_01970.1_g00004.1 22 RKRKRMLSNRESARRSRMKKQKLLDDLTAQVNQLKEQNNEIVTSVSITTQHYLTV 76
                             7889**********************************98777766666666555 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.4E-101664No hitNo description
SMARTSM003381.1E-161882IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1052083IPR004827Basic-leucine zipper domain
PfamPF001701.6E-82163IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.58E-122275No hitNo description
CDDcd147024.90E-172373No hitNo description
PROSITE patternPS0003602540IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MEPSSSGTTS PSGSEESLME QRKRKRMLSN RESARRSRMK KQKLLDDLTA QVNQLKEQNN  60
EIVTSVSITT QHYLTVEAEN SVLRAQLHEL SHRLESLNDI IELLDSTNGI CPSLLTGPEP  120
DDFLVNQMNT NMFCMNQLLM ASSDALLY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12142RKRKRMLSNRESARRSRMKKQK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_01970.1_g00004.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895291e-116AC189529.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB092P05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018447529.11e-103PREDICTED: bZIP transcription factor 11-like
SwissprotO656833e-68BZP11_ARATH; bZIP transcription factor 11
TrEMBLA0A078H3Z36e-86A0A078H3Z3_BRANA; BnaA10g13430D protein
TrEMBLA0A3P6B5166e-86A0A3P6B516_BRAOL; Uncharacterized protein
STRINGBra034639.1-P1e-86(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.13e-68G-box binding factor 6
Publications ? help Back to Top
  1. Mair A, et al.
    SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants.
    Elife, 2016.
    [PMID:26263501]
  2. Sagor GH, et al.
    A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene.
    Plant Biotechnol. J., 2016. 14(4): p. 1116-26
    [PMID:26402509]
  3. Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W
    Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins.
    PLoS ONE, 2016. 11(4): p. e0153216
    [PMID:27073862]
  4. Wang XY, et al.
    Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis.
    Plant Physiol. Biochem., 2016. 107: p. 273-287
    [PMID:27337039]
  5. Weiste C, et al.
    The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth.
    PLoS Genet., 2017. 13(2): p. e1006607
    [PMID:28158182]
  6. Yamashita Y, et al.
    Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2.
    FEBS Lett., 2017. 591(9): p. 1266-1277
    [PMID:28369795]
  7. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  8. Lee DH,Park SJ,Ahn CS,Pai HS
    MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway.
    Plant Cell, 2017. 29(11): p. 2895-2920
    [PMID:29084871]
  9. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]