![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_02075.1_g00003.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | Trihelix | ||||||||
| Protein Properties | Length: 117aa MW: 13834.9 Da PI: 9.7351 | ||||||||
| Description | Trihelix family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | trihelix | 68 | 1.9e-21 | 44 | 107 | 1 | 64 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykki 64
+W+ +e ++Li++r e+++++ ++k++k lWe vs+kmr++ f rsp+qCk+kw+nl +r+k +
Rsa1.0_02075.1_g00003.1 44 QWSLEESKELIAIRGELDQTFMETKRNKLLWEVVSNKMRDKSFLRSPEQCKCKWKNLVTRFKLE 107
7************************************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 0.0061 | 41 | 103 | IPR001005 | SANT/Myb domain |
| CDD | cd12203 | 1.78E-25 | 43 | 105 | No hit | No description |
| Pfam | PF13837 | 4.8E-16 | 44 | 107 | No hit | No description |
| PROSITE profile | PS50090 | 7.596 | 45 | 101 | IPR017877 | Myb-like domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
MAGHQHQLHH LQFLNKHHHH VHPQSQTPEI ASPATVAAGD RFPQWSLEES KELIAIRGEL 60 DQTFMETKRN KLLWEVVSNK MRDKSFLRSP EQCKCKWKNL VTRFKLEVVH ETMLYTK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ebi_A | 1e-13 | 41 | 105 | 3 | 67 | DNA binding protein GT-1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may play a role in the induction of CAM4 in response to pathogen and salt. {ECO:0000269|PubMed:15310827}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_02075.1_g00003.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salt and infection with the bacterial pathogen P.syringae pv tomato. {ECO:0000269|PubMed:15310827}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC003028 | 7e-82 | AC003028.3 Arabidopsis thaliana chromosome 2 clone F16M14 map ve018, complete sequence. | |||
| GenBank | AF453582 | 7e-82 | AF453582.1 Arabidopsis thaliana GT-1 like transcription factor (GT1L) mRNA, complete cds. | |||
| GenBank | AY271678 | 7e-82 | AY271678.1 Arabidopsis thaliana transcription factor GT-3b (GT3B) mRNA, complete cds. | |||
| GenBank | CP002685 | 7e-82 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009133240.1 | 9e-70 | PREDICTED: trihelix transcription factor GT-3b-like | ||||
| Refseq | XP_013740623.1 | 9e-70 | trihelix transcription factor GT-3b-like | ||||
| Swissprot | O80450 | 1e-50 | TGT3B_ARATH; Trihelix transcription factor GT-3b | ||||
| TrEMBL | M4C768 | 2e-68 | M4C768_BRARP; Uncharacterized protein | ||||
| STRING | Bra000046.1-P | 3e-69 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2215 | 28 | 70 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38250.1 | 7e-49 | Trihelix family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




