PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_03605.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

MYB_related

Protein Properties

Length: 160aa MW: 18637.1 Da PI: 9.8307

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_03605.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.3	3.6e-18	31	76	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++ Rsa1.0_03605.1_g00001.1 31 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 76 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50090	4.855	1	25	IPR017877	Myb-like domain
SuperFamily	SSF46689	5.72E-23	11	81	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.6E-10	11	37	IPR009057	Homeodomain-like
PROSITE profile	PS51294	27.868	26	80	IPR017930	Myb domain
SMART	SM00717	2.2E-17	30	78	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-16	31	75	IPR001005	SANT/Myb domain
CDD	cd00167	1.81E-12	33	76	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.5E-21	38	77	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MKSVQEEYRL NRTGKSCRLR WVNYLNPGLK RGKMTPQEER LVLELHAKWG NRWSKIARKL 60 PGRTDNEIKN YWRTHMRKKA QEKKRHMSPT SSSSNCCSSS MTTAATPDTG GSNGKMNQEC 120 EDGYYSMDDI WRELDQSGAN IIKPVKDIYY SEQSCYLNFP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	3e-20	3	80	28	105	MYB PROTO-ONCOGENE PROTEIN
1mse_C	3e-20	3	80	28	105	C-Myb DNA-Binding Domain
1msf_C	3e-20	3	80	28	105	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_03605.1_g00001.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK229048	1e-153	AK229048.1 Arabidopsis thaliana mRNA for MYB27 protein - like, complete cds, clone: RAFL16-34-F17.
GenBank	AY519641	1e-153	AY519641.1 Arabidopsis thaliana MYB transcription factor (At5g59780) mRNA, complete cds.
GenBank	DQ075252	1e-153	DQ075252.1 Arabidopsis thaliana MYB transcription factor MYB59-1 (At5g59780) mRNA, complete cds, alternatively spliced.
GenBank	DQ075253	1e-153	DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018472596.1	1e-99	PREDICTED: transcription factor MYB59 isoform X1
Swissprot	Q4JL84	5e-93	MYB59_ARATH; Transcription factor MYB59
TrEMBL	A0A0D3B2J6	1e-94	A0A0D3B2J6_BRAOL; Uncharacterized protein
STRING	XP_010443755.1	3e-96	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2502	27	74

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59780.2	7e-90	myb domain protein 59

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]