![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_04138.1_g00005.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 132aa MW: 14655.6 Da PI: 7.7887 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 138.3 | 2.6e-43 | 13 | 111 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86
+CaaCk+lrrkC+++Cv+apyfp e+p kfanvh++FGasnv+k+l+++ +++reda++sl+yeAear++dPvyG+vg i+ lq++
Rsa1.0_04138.1_g00005.1 13 PCAACKFLRRKCTSECVFAPYFPPEEPLKFANVHRIFGASNVSKILHEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRE 98
7************************************************************************************* PP
DUF260 87 leqlkaelallke 99
+ +l+ el+++++
Rsa1.0_04138.1_g00005.1 99 VLRLQRELEETNA 111
********99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 26.993 | 12 | 113 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 8.9E-43 | 13 | 110 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 132 aa Download sequence Send to blast |
MSSSSYSNYT NSPCAACKFL RRKCTSECVF APYFPPEEPL KFANVHRIFG ASNVSKILHE 60 VAPHQREDAV NSLAYEAEAR LKDPVYGCVG AISVLQREVL RLQRELEETN ADLMRYASCL 120 GGETSAYGGR RG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-59 | 11 | 126 | 9 | 125 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-59 | 11 | 126 | 9 | 125 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_04138.1_g00005.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB018114 | 1e-116 | AB018114.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGF10. | |||
| GenBank | AB164304 | 1e-116 | AB164304.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like gene 3 protein, partial cds. | |||
| GenBank | AB473836 | 1e-116 | AB473836.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like 3 protein, complete cds. | |||
| GenBank | AF447892 | 1e-116 | AF447892.1 Arabidopsis thaliana LOB DOMAIN 25 (LBD25) mRNA, complete cds. | |||
| GenBank | CP002686 | 1e-116 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018453069.1 | 7e-94 | PREDICTED: LOB domain-containing protein 25 | ||||
| Swissprot | Q8L8Q3 | 5e-87 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
| TrEMBL | A0A291LR18 | 2e-90 | A0A291LR18_BRARR; Transcription factor LBD25 | ||||
| TrEMBL | A0A397Y063 | 2e-90 | A0A397Y063_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4FDA2 | 2e-90 | M4FDA2_BRARP; Uncharacterized protein | ||||
| STRING | Bra039072.1-P | 4e-91 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27650.1 | 5e-71 | LOB domain-containing protein 25 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




