![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_04938.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 120aa MW: 13357 Da PI: 9.6946 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 124.1 | 4.5e-39 | 33 | 93 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rk+ k+s
Rsa1.0_04938.1_g00001.1 33 QQEQLPCPRCESTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKSAKRS 93
68999***************************************************98875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF02701 | 9.0E-34 | 35 | 91 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 29.04 | 37 | 91 | IPR003851 | Zinc finger, Dof-type |
| ProDom | PD007478 | 1.0E-25 | 39 | 91 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 39 | 75 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 120 aa Download sequence Send to blast |
MMMSDSGESR QIATRSPHGV ITGLPPPTTT TEQQEQLPCP RCESTNTKFC YYNNYNFSQP 60 RHFCKSCRRY WTHGGTLRDI PVGGGTRKSA KRSRTCPSST SSSSSRDVPL QATPVLFPHS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_04938.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY225586 | 1e-109 | AY225586.1 Brassica rapa subsp. oleifera HRa (HRa), HRb (HRb), and HRc (HRc) genes, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018434956.1 | 4e-85 | PREDICTED: dof zinc finger protein DOF3.4-like | ||||
| Swissprot | Q9FGD6 | 2e-51 | DOF58_ARATH; Dof zinc finger protein DOF5.8 | ||||
| TrEMBL | A0A078FZK4 | 1e-66 | A0A078FZK4_BRANA; BnaC08g21910D protein | ||||
| TrEMBL | A0A0D3DRY3 | 1e-66 | A0A0D3DRY3_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6GAI9 | 1e-66 | A0A3P6GAI9_BRAOL; Uncharacterized protein | ||||
| STRING | Bo8g079910.1 | 2e-67 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2286 | 28 | 74 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G50410.1 | 8e-41 | OBF binding protein 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




