![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_04960.1_g00002.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 101aa MW: 11153.5 Da PI: 4.9612 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 51.6 | 2.7e-16 | 2 | 50 | 52 | 100 |
DUF260 52 eeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
++r+da++slvyeA+a+++dPvyG+vg+i++l++qle+l+++la +++e
Rsa1.0_04960.1_g00002.1 2 NHRSDALNSLVYEANAKVQDPVYGCVGTISSLNRQLETLQTQLAFAQAE 50
579*****************************************99987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 10.411 | 1 | 51 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.7E-13 | 2 | 48 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MNHRSDALNS LVYEANAKVQ DPVYGCVGTI SSLNRQLETL QTQLAFAQAE LVHMKMLQHV 60 DTKSPPYIAS GITFPANKDF SSDVDMAFVY DNGAGESLWS R |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_04960.1_g00002.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cytokinin. {ECO:0000269|PubMed:17485849}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009149087.1 | 1e-58 | PREDICTED: LOB domain-containing protein 3 | ||||
| Refseq | XP_013641646.1 | 1e-58 | LOB domain-containing protein 3 | ||||
| Refseq | XP_013659026.1 | 1e-58 | LOB domain-containing protein 3 | ||||
| Refseq | XP_013710686.1 | 1e-58 | LOB domain-containing protein 3-like | ||||
| Swissprot | Q9SA51 | 5e-51 | LBD3_ARATH; LOB domain-containing protein 3 | ||||
| TrEMBL | A0A078HS02 | 3e-57 | A0A078HS02_BRANA; BnaC05g12610D protein | ||||
| TrEMBL | A0A078JJD7 | 3e-57 | A0A078JJD7_BRANA; BnaA06g38340D protein | ||||
| TrEMBL | A0A291LQZ1 | 3e-57 | A0A291LQZ1_BRARR; Transcription factor LBD3 | ||||
| TrEMBL | A0A397Z3B7 | 3e-57 | A0A397Z3B7_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3N6QCN1 | 3e-57 | A0A3N6QCN1_BRACR; Uncharacterized protein | ||||
| TrEMBL | A0A3P6FEE1 | 3e-57 | A0A3P6FEE1_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6FL12 | 3e-57 | A0A3P6FL12_BRAOL; Uncharacterized protein | ||||
| TrEMBL | M4EB83 | 3e-57 | M4EB83_BRARP; Uncharacterized protein | ||||
| STRING | Bra026042.1-P | 5e-58 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G16530.1 | 2e-53 | ASYMMETRIC LEAVES 2-like 9 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




