![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_07505.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 83aa MW: 9339.63 Da PI: 9.8437 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 97.8 | 4.6e-31 | 24 | 74 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey++
Rsa1.0_07505.1_g00001.1 24 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAN 74
79***********************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.973 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.4E-38 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.58E-29 | 18 | 76 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.25E-37 | 18 | 75 | No hit | No description |
| PRINTS | PR00404 | 5.9E-33 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.7E-27 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.9E-33 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.9E-33 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MEEGGSSHDA ESSKKLVRGK IEIKRIENTT SRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 VIFSTRGRLY EYANNRYASP APS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_07505.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189647 | 1e-131 | AC189647.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS009G24, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001078311.1 | 2e-47 | K-box region and MADS-box transcription factor family protein | ||||
| Refseq | XP_009104172.1 | 4e-47 | PREDICTED: agamous-like MADS-box protein AGL1 | ||||
| Swissprot | P29381 | 2e-46 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
| TrEMBL | A0A3P6C5M6 | 3e-46 | A0A3P6C5M6_BRAOL; Uncharacterized protein | ||||
| STRING | Bra003356.1-P | 6e-46 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 8e-51 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




