![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_07942.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 76aa MW: 8229.98 Da PI: 10.796 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 138.7 | 1.3e-43 | 8 | 76 | 2 | 70 |
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
++a++eakGlnPGlivllv+gg+l+vflv+ny++yvyaqknlPPrkkkPvskkklkreklkqGv+vPGe
Rsa1.0_07942.1_g00001.1 8 GKAAAEAKGLNPGLIVLLVIGGPLVVFLVANYVMYVYAQKNLPPRKKKPVSKKKLKREKLKQGVPVPGE 76
57899***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 3.1E-38 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MDKEGFAGKA AAEAKGLNPG LIVLLVIGGP LVVFLVANYV MYVYAQKNLP PRKKKPVSKK 60 KLKREKLKQG VPVPGE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_07942.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189269 | 2e-87 | AC189269.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB023B16, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018442736.1 | 1e-45 | PREDICTED: DNA-binding protein S1FA1 | ||||
| Swissprot | Q42337 | 3e-24 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | A0A078J2Z0 | 4e-22 | A0A078J2Z0_BRANA; BnaCnng30990D protein | ||||
| TrEMBL | A0A3P6GBG2 | 4e-22 | A0A3P6GBG2_BRAOL; Uncharacterized protein | ||||
| STRING | XP_010104121.1 | 9e-23 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2823 | 27 | 69 |




