![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_14464.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | Trihelix | ||||||||
| Protein Properties | Length: 107aa MW: 12267 Da PI: 9.815 | ||||||||
| Description | Trihelix family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | trihelix | 66 | 8.2e-21 | 46 | 107 | 1 | 62 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkryk 62
+W+ +e+++L+ +r+e+++++ ++ + k lW+ v++km+++gf rs++qCk+kw+nl ryk
Rsa1.0_14464.1_g00001.1 46 QWSIDETKELLGIREELDQTFMEATRTKLLWQVVAAKMADKGFARSAEQCKSKWKNLVSRYK 107
7************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd12203 | 3.46E-20 | 45 | 107 | No hit | No description |
| Pfam | PF13837 | 3.2E-16 | 46 | 107 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.8E-4 | 46 | 103 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 7.805 | 47 | 103 | IPR017877 | Myb-like domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MDRRNPFHHH HQLHHLIQQQ QLPPPPQSTP AAMDLGGGGG GERIPQWSID ETKELLGIRE 60 ELDQTFMEAT RTKLLWQVVA AKMADKGFAR SAEQCKSKWK NLVSRYK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_14464.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC240935 | 1e-128 | AC240935.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrF042C17, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018469212.1 | 1e-75 | PREDICTED: trihelix transcription factor GT-3a | ||||
| Swissprot | Q9SDW0 | 5e-38 | TGT3A_ARATH; Trihelix transcription factor GT-3a | ||||
| TrEMBL | A0A397ZQE1 | 8e-53 | A0A397ZQE1_BRACM; Uncharacterized protein | ||||
| STRING | Bo3g001460.1 | 7e-51 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2215 | 28 | 70 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G01380.1 | 7e-39 | Trihelix family protein | ||||




