| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 33.3 | 1.1e-10 | 34 | 73 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+ +eE++l + +k+ G++ W++Ia +++ gRt++++ +w
Rsa1.0_15346.1_g00001.1 34 MNQEEEDLVCRMHKLVGNR-WELIAGRIP-GRTAEEVERFWV 73
679****************.*********.**********95 PP
|
| Publications
? help Back to Top |
- Koiwa H, et al.
C-terminal domain phosphatase-like family members (AtCPLs) differentially regulate Arabidopsis thaliana abiotic stress signaling, growth, and development. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(16): p. 10893-8 [PMID:12149434] - Savage N, et al.
Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] - Nemie-Feyissa D,Olafsdottir SM,Heidari B,Lillo C
Nitrogen depletion and small R3-MYB transcription factors affecting anthocyanin accumulation in Arabidopsis leaves. Phytochemistry, 2014. 98: p. 34-40 [PMID:24388610] - Nayidu NK, et al.
Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] - Wada T,Hayashi N,Tominaga-Wada R
Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] - Huang M,Hu Y,Liu X,Li Y,Hou X
Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] - Wada T,Tominaga-Wada R
CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] - Tominaga-Wada R,Wada T
The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis. J. Plant Physiol., 2016. 199: p. 111-115 [PMID:27302012] - Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] - Tominaga-Wada R,Kurata T,Wada T
Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis. J. Plant Physiol., 2017. 214: p. 48-52 [PMID:28437677] - Tominaga-Wada R,Kurata T,Wada T
Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis. Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767 [PMID:28644769] - Tominaga-Wada R,Wada T
Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] - Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] - Tominaga-Wada R,Wada T
Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis. Dev. Biol., 2018. 435(1): p. 1-5 [PMID:29337129] - Kohanová J, et al.
Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308] - Huang KC,Lin WC,Cheng WH
Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]
|