PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_15651.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

NAC

Protein Properties

Length: 179aa MW: 20210.4 Da PI: 7.0681

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_15651.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	39.7	1.5e-12	1	42	86	128
NAM 86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 tg dk+v+s + vglkk+Lv+y g+a kg+ktdW+mhe+rl Rsa1.0_15651.1_g00001.1 1 TGIDKPVYS-NLDCVGLKKSLVYYLGSAGKGSKTDWMMHEFRL 42 7999***.9999*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.66E-17	1	64	IPR003441	NAC domain
PROSITE profile	PS51005	21.361	1	65	IPR003441	NAC domain
Pfam	PF02365	1.0E-4	14	42	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 179 aa Download sequence Send to blast
TGIDKPVYSN LDCVGLKKSL VYYLGSAGKG SKTDWMMHEF RLPSSSESPT PQAAEVWTLC 60 RIFKRVTHHR NPTIVQPNRR PVITLTDSGS KTSSLDSDHT SHHVVESLSH KLHEPQFQPQ 120 TQNPYYNQLT TVGFNQPTYN TCHENNFLNL WNINGGDFIG DATSWDELRS VIDGNTNHL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-13	1	65	101	165	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-13	1	65	101	165	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-13	1	65	101	165	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-13	1	65	101	165	NO APICAL MERISTEM PROTEIN
3swm_A	4e-13	1	65	104	168	NAC domain-containing protein 19
3swm_B	4e-13	1	65	104	168	NAC domain-containing protein 19
3swm_C	4e-13	1	65	104	168	NAC domain-containing protein 19
3swm_D	4e-13	1	65	104	168	NAC domain-containing protein 19
3swp_A	4e-13	1	65	104	168	NAC domain-containing protein 19
3swp_B	4e-13	1	65	104	168	NAC domain-containing protein 19
3swp_C	4e-13	1	65	104	168	NAC domain-containing protein 19
3swp_D	4e-13	1	65	104	168	NAC domain-containing protein 19
4dul_A	4e-13	1	65	101	165	NAC domain-containing protein 19
4dul_B	4e-13	1	65	101	165	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269\|PubMed:22345491}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_15651.1_g00001.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269\|PubMed:22345491}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018481287.1	1e-128	PREDICTED: transcription factor JUNGBRUNNEN 1-like
Swissprot	Q9SK55	3e-88	NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBL	A0A078H0L4	1e-112	A0A078H0L4_BRANA; BnaA04g24740D protein
TrEMBL	A0A397ZQL5	1e-112	A0A397ZQL5_BRACM; Uncharacterized protein
TrEMBL	M4F9I0	1e-112	M4F9I0_BRARP; Uncharacterized protein
STRING	Bra037743.1-P	1e-112	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM306	28	200

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G43000.1	3e-79	NAC domain containing protein 42

Publications ? help Back to Top
Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins. Plant Signal Behav, 2016. 11(6): p. e1181245 [PMID:27159137] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Shahnejat-Bushehri S, et al. Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato. Front Plant Sci, 2017. 8: p. 214 [PMID:28326087] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Ebrahimian-Motlagh S, et al. JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13. Front Plant Sci, 2017. 8: p. 2118 [PMID:29326734]