 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Rsa1.0_15656.1_g00002.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
| Family |
HRT-like |
| Protein Properties |
Length: 125aa MW: 13958 Da PI: 8.7188 |
| Description |
HRT-like family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Rsa1.0_15656.1_g00002.1 | genome | RGD | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | HRT-like | 57 | 3.1e-18 | 91 | 120 | 2 | 31 |
HRT-like 2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31
CGv l +G +C+r+PvkgRKRCeeHKGmRi
Rsa1.0_15656.1_g00002.1 91 CGVQLCNGLICERSPVKGRKRCEEHKGMRI 120
*****************************7 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional regulator involved in the regulation of cell differentiation in meristems. Probably regulates the expression of various KNAT genes involved in the maintenance of the cells in an undifferentiated, merismastic state. Plays a role in the regulation of gibberellin 20 oxidase and the gibberellin-regulated protein GASA4. Localizes in the nucleus during the cellular differentiation state and may act via a single strand cutting domain (PubMed:17991462). Transcriptional regulator required for the induction of dormancy during late seed development. Interacts genetically with FUS3 and may be component of the same regulatory pathway during embryogenesis. Binds both linear and supercoiled DNA without sequence preference (PubMed:22226340). {ECO:0000269|PubMed:17991462, ECO:0000269|PubMed:22226340}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AB013392 | 5e-58 | AB013392.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MIK19. |
| GenBank | CP002688 | 5e-58 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |