![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_18284.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 61aa MW: 6913.13 Da PI: 11.5883 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 94.7 | 4.3e-30 | 10 | 58 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
rienk++rqvtfskRr+g+ KKA+E+SvLCda+va+i+fs++gkl+eys
Rsa1.0_18284.1_g00001.1 10 RIENKIRRQVTFSKRRTGLVKKAQEISVLCDADVALIVFSTKGKLFEYS 58
8***********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 30.684 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.1E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.57E-27 | 2 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MGRGRVQLRR IENKIRRQVT FSKRRTGLVK KAQEISVLCD ADVALIVFST KGKLFEYSAG 60 S |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 6e-19 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_B | 6e-19 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_C | 6e-19 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_D | 6e-19 | 1 | 59 | 1 | 59 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269|PubMed:10648231, ECO:0000269|PubMed:15035986, ECO:0000269|PubMed:28586421, ECO:0000269|PubMed:9502732}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_18284.1_g00001.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP001314 | 1e-72 | AP001314.1 Arabidopsis thaliana genomic DNA, chromosome 3, BAC clone:T6J22. | |||
| GenBank | AY141238 | 1e-72 | AY141238.1 Arabidopsis thaliana MADS-box protein AGL79 mRNA, complete cds. | |||
| GenBank | CP002686 | 1e-72 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010425772.1 | 4e-35 | PREDICTED: truncated transcription factor CAULIFLOWER A-like | ||||
| Refseq | XP_010502999.1 | 4e-35 | PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X1 | ||||
| Refseq | XP_010503000.1 | 3e-35 | PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2 | ||||
| Refseq | XP_010514674.1 | 3e-35 | PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X1 | ||||
| Refseq | XP_010514677.1 | 3e-35 | PREDICTED: truncated transcription factor CAULIFLOWER D-like isoform X2 | ||||
| Swissprot | Q38876 | 1e-30 | AGL8_ARATH; Agamous-like MADS-box protein AGL8 | ||||
| TrEMBL | A0A078HDI9 | 2e-34 | A0A078HDI9_BRANA; BnaC02g38130D protein | ||||
| STRING | Bostr.0556s0620.1.p | 1e-34 | (Boechera stricta) | ||||
| STRING | XP_010425772.1 | 1e-34 | (Camelina sativa) | ||||
| STRING | XP_010502999.1 | 1e-34 | (Camelina sativa) | ||||
| STRING | XP_010514674.1 | 1e-34 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30260.1 | 3e-37 | AGAMOUS-like 79 | ||||




