![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_22149.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 136aa MW: 15389.7 Da PI: 10.1317 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 51.1 | 1.8e-16 | 10 | 50 | 2 | 42 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
+i n+s r++t+ kR+ g+lKKA E+ +LC+++v ii+s+
Rsa1.0_22149.1_g00001.1 10 FIINNSSRKTTYKKRKRGLLKKAREIFTLCGINVGAIIYSP 50
78899**********************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 17.03 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.8E-21 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 1.86E-15 | 2 | 83 | No hit | No description |
| SuperFamily | SSF55455 | 5.89E-23 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.2E-10 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.4E-15 | 10 | 51 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.2E-10 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.2E-10 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MTRSKVKLAF IINNSSRKTT YKKRKRGLLK KAREIFTLCG INVGAIIYSP YDPTPEVWPS 60 VDGMNQVITT FRNLPEIDRH NNMIGQLTFL AGGHNNPALA RDLNDLGYLV DQYLNRLNRR 120 IQILEGGSDV EIGESL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_22149.1_g00001.1 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB608492 | 1e-68 | AB608492.1 Raphanus sativus DNA, microsatellite locus RsSH024, cultivar: rat-tail radish. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018444906.1 | 2e-74 | PREDICTED: agamous-like MADS-box protein AGL80 | ||||
| Swissprot | Q9FJK3 | 1e-35 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
| TrEMBL | A0A0D3CMG8 | 3e-44 | A0A0D3CMG8_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3N6SXQ4 | 3e-44 | A0A3N6SXQ4_BRACR; Uncharacterized protein | ||||
| TrEMBL | A0A3P6FJD5 | 2e-44 | A0A3P6FJD5_BRAOL; Uncharacterized protein | ||||
| STRING | Bo5g145000.1 | 5e-45 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM70 | 28 | 415 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G48670.1 | 2e-34 | AGAMOUS-like 80 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




