PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_22297.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

HB-other

Protein Properties

Length: 76aa MW: 8866.87 Da PI: 11.1196

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_22297.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	60.8	2.1e-19	22	72	1	51
TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHH CS Homeobox 1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNr 51 +++ +++t++q+++Le+ F+++++p+ ++r +L+++lgL r++k+WFqNr Rsa1.0_22297.1_g00001.1 22 KKRYHRHTSQQIQRLESSFKECPHPDDKQRNQLSRELGLAPRRIKFWFQNR 72 688999********************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-22	7	72	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.18E-18	9	72	IPR009057	Homeodomain-like
PROSITE profile	PS50071	15.791	19	76	IPR001356	Homeobox domain
SMART	SM00389	5.6E-10	20	75	IPR001356	Homeobox domain
CDD	cd00086	4.74E-12	22	72	No hit	No description
Pfam	PF00046	4.9E-17	22	72	IPR001356	Homeobox domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 76 aa Download sequence Send to blast
VSGGDGGGGS QHHDGTKTDR KKKRYHRHTS QQIQRLESSF KECPHPDDKQ RNQLSRELGL 60 APRRIKFWFQ NRITQL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor which acts as positive regulator of drought stress tolerance. Can transactivate CIPK3, NCED3 and ERECTA (PubMed:18451323). Transactivates several cell-wall-loosening protein genes by directly binding to HD motifs in their promoters. These target genes play important roles in coordinating cell-wall extensibility with root development and growth (PubMed:24821957). Transactivates CYP74A/AOS, AOC3, OPR3 and 4CLL5/OPCL1 genes by directly binding to HD motifs in their promoters. These target genes are involved in jasmonate (JA) biosynthesis, and JA signaling affects root architecture by activating auxin signaling, which promotes lateral root formation (PubMed:25752924). Acts as negative regulator of trichome branching (PubMed:16778018, PubMed:24824485). Required for the establishment of giant cell identity on the abaxial side of sepals (PubMed:23095885). May regulate cell differentiation and proliferation during root and shoot meristem development (PubMed:25564655). {ECO:0000269\|PubMed:16778018, ECO:0000269\|PubMed:18451323, ECO:0000269\|PubMed:23095885, ECO:0000269\|PubMed:24821957, ECO:0000269\|PubMed:24824485, ECO:0000269\|PubMed:25564655, ECO:0000269\|PubMed:25752924}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_22297.1_g00001.1

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ166821	2e-84	DQ166821.1 Brassica napus baby boom interacting protein 1A (BIP1A) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018457296.1	7e-38	PREDICTED: homeobox-leucine zipper protein HDG11-like
Swissprot	Q9FX31	1e-33	HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBL	A0A1J3D2R7	6e-37	A0A1J3D2R7_NOCCA; Homeobox-leucine zipper protein HDG11 (Fragment)
TrEMBL	V4M9K6	2e-36	V4M9K6_EUTSA; Uncharacterized protein
STRING	XP_006390565.1	4e-37	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM17003	6	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G73360.1	1e-35	homeodomain GLABROUS 11

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Khosla A, et al. HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23. Plant Cell, 2014. 26(5): p. 2184-2200 [PMID:24824485] Horstman A, et al. AIL and HDG proteins act antagonistically to control cell proliferation. Development, 2015. 142(3): p. 454-64 [PMID:25564655] Cai XT,Xu P,Wang Y,Xiang CB Activated expression of AtEDT1/HDG11 promotes lateral root formation in Arabidopsis mutant edt1 by upregulating jasmonate biosynthesis. J Integr Plant Biol, 2015. 57(12): p. 1017-30 [PMID:25752924] Yu LH, et al. Arabidopsis EDT1/HDG11 improves drought and salt tolerance in cotton and poplar and increases cotton yield in the field. Plant Biotechnol. J., 2016. 14(1): p. 72-84 [PMID:25879154] Zhu Z, et al. Overexpression of AtEDT1/HDG11 in Chinese Kale (Brassica oleracea var. alboglabra) Enhances Drought and Osmotic Stress Tolerance. Front Plant Sci, 2016. 7: p. 1285 [PMID:27625663] Liu Y, et al. Overexpression of AtEDT1 promotes root elongation and affects medicinal secondary metabolite biosynthesis in roots of transgenic Salvia miltiorrhiza. Protoplasma, 2017. 254(4): p. 1617-1625 [PMID:27915455] Ueda M, et al. Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote. Genes Dev., 2017. 31(6): p. 617-627 [PMID:28404632] Lung SC, et al. Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors. New Phytol., 2018. 218(1): p. 183-200 [PMID:29288621] Zheng G, et al. Over-Expression of Arabidopsis EDT1 Gene Confers Drought Tolerance in Alfalfa (Medicago sativa L.). Front Plant Sci, 2017. 8: p. 2125 [PMID:29326737]