![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_26460.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 141aa MW: 15663 Da PI: 11.3819 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 57.6 | 1.7e-18 | 61 | 95 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++C + kTp+WR gp g+ktLCnaCG+++++ +l
Rsa1.0_26460.1_g00001.1 61 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 95
*******************************9885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 8.55E-15 | 54 | 117 | No hit | No description |
| SMART | SM00401 | 1.1E-15 | 55 | 105 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.385 | 55 | 91 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 4.2E-14 | 59 | 93 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.36E-12 | 60 | 107 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 61 | 86 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 2.7E-16 | 61 | 95 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 141 aa Download sequence Send to blast |
MTVRPEMSFT GKPRSRRSRA LVPSVAGTWA PTPEAELCRS VAKRKPTKKL EAAEGGGARR 60 CTHCASEKTP QWRTGPLGPK TLCNACGVRF KSGRLVPEYR PASSPTFVST QHSNSHRKVM 120 ELRRQKEQLE SAVHLLPFQP Q |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_26460.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353196 | 1e-110 | AK353196.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-22-H09. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018444168.1 | 1e-100 | PREDICTED: GATA transcription factor 4-like | ||||
| Swissprot | O49743 | 1e-78 | GATA4_ARATH; GATA transcription factor 4 | ||||
| TrEMBL | A0A397YRL4 | 2e-91 | A0A397YRL4_BRACM; GATA transcription factor | ||||
| TrEMBL | M4CGT6 | 2e-91 | M4CGT6_BRARP; GATA transcription factor | ||||
| STRING | Bra003419.1-P | 3e-92 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3203 | 26 | 66 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G60530.1 | 5e-81 | GATA transcription factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




