![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_31010.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | Trihelix | ||||||||
| Protein Properties | Length: 107aa MW: 12508.2 Da PI: 9.1092 | ||||||||
| Description | Trihelix family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | trihelix | 67.6 | 2.6e-21 | 46 | 107 | 1 | 62 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkryk 62
+W+ +e+++L+ +r+e+++++ ++k++k lWe v++km ++gf rs++qCk+kw+nl +ryk
Rsa1.0_31010.1_g00001.1 46 QWSIEETRELLGIREELDQTFMETKRNKLLWEVVAAKMVDKGFARSAEQCKSKWKNLVTRYK 107
7************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 9.4E-5 | 45 | 103 | IPR009057 | Homeodomain-like |
| CDD | cd12203 | 2.81E-24 | 45 | 107 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 7.0E-5 | 46 | 102 | IPR009057 | Homeodomain-like |
| Pfam | PF13837 | 5.3E-17 | 46 | 107 | No hit | No description |
| PROSITE profile | PS50090 | 8.037 | 47 | 103 | IPR017877 | Myb-like domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MDRSNPFYHR DHQLYHLIQQ QQLSLPPQST TAAMDSGVGG GERIPQWSIE ETRELLGIRE 60 ELDQTFMETK RNKLLWEVVA AKMVDKGFAR SAEQCKSKWK NLVTRYK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_31010.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189362 | 1e-144 | AC189362.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB045I17, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018475903.1 | 4e-75 | PREDICTED: trihelix transcription factor GT-3a-like | ||||
| Swissprot | Q9SDW0 | 4e-40 | TGT3A_ARATH; Trihelix transcription factor GT-3a | ||||
| TrEMBL | A0A078FGM7 | 1e-55 | A0A078FGM7_BRANA; BnaA03g00390D protein | ||||
| TrEMBL | A0A0D3AZB1 | 1e-55 | A0A0D3AZB1_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P5ZCN2 | 1e-55 | A0A3P5ZCN2_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P5ZXC6 | 1e-55 | A0A3P5ZXC6_BRAOL; Uncharacterized protein | ||||
| STRING | Bo3g001460.1 | 2e-56 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM37720 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G01380.1 | 5e-40 | Trihelix family protein | ||||




