![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_32232.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 75aa MW: 8956.37 Da PI: 11.2001 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 48.3 | 2.2e-15 | 31 | 73 | 5 | 47 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47
+r+rr++kNRe+A rsR+R++a++ eLe + +L++eN++Lkk
Rsa1.0_32232.1_g00001.1 31 RRQRRMIKNRESAARSRARRQAYTVELELELNQLTEENMKLKK 73
79***************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 1.0E-5 | 24 | 74 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.829 | 29 | 75 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 7.3E-15 | 30 | 73 | No hit | No description |
| Pfam | PF00170 | 2.6E-13 | 31 | 74 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 5.81E-11 | 31 | 73 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 34 | 49 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 75 aa Download sequence Send to blast |
NGRSEQYLTG LNAFRIQKRI IDGPPEILME RRQRRMIKNR ESAARSRARR QAYTVELELE 60 LNQLTEENMK LKKIV |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Could participate in abscisic acid-regulated gene expression during seed development. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_32232.1_g00001.1 |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018437699.1 | 2e-44 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 | ||||
| Refseq | XP_018437731.1 | 2e-44 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 | ||||
| Swissprot | Q8RYD6 | 2e-32 | AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1 | ||||
| TrEMBL | A0A078F7P7 | 5e-42 | A0A078F7P7_BRANA; BnaCnng04010D protein | ||||
| STRING | XP_010535682.1 | 1e-35 | (Tarenaya hassleriana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM11652 | 22 | 30 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G44460.1 | 2e-23 | bZIP family protein | ||||




