![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_34969.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 109aa MW: 12856.9 Da PI: 10.1269 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 136 | 2.5e-42 | 3 | 96 | 36 | 129 |
NAM 36 evdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdW 121
e+d++k+ePwdLpk++k +eke yfF++rd+ky+tg r+nrat+sgyWkatgkdke+++ kg lvg+kktLvfy+grap+gekt+W
Rsa1.0_34969.1_g00001.1 3 EADLNKCEPWDLPKMAKMGEKEFYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIFKGKGCLVGMKKTLVFYRGRAPRGEKTNW 88
78***********9999999***************************************9************************** PP
NAM 122 vmheyrle 129
vmheyrle
Rsa1.0_34969.1_g00001.1 89 VMHEYRLE 96
******85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 41.04 | 1 | 109 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.31E-42 | 3 | 97 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.5E-18 | 11 | 95 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MGEADLNKCE PWDLPKMAKM GEKEFYFFCQ RDRKYPTGMR TNRATESGYW KATGKDKEIF 60 KGKGCLVGMK KTLVFYRGRA PRGEKTNWVM HEYRLEGIYS YHNLPKTAR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 4e-36 | 1 | 95 | 49 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 4e-36 | 1 | 95 | 49 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 4e-36 | 1 | 95 | 49 | 142 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 4e-36 | 1 | 95 | 49 | 142 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
| 4dul_A | 4e-36 | 1 | 95 | 49 | 142 | NAC domain-containing protein 19 |
| 4dul_B | 4e-36 | 1 | 95 | 49 | 142 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_34969.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KP641357 | 1e-135 | KP641357.1 Brassica napus NAC transcription factor 87.1 (NAC87.1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018473507.1 | 4e-77 | PREDICTED: NAC domain-containing protein 79-like | ||||
| Swissprot | Q9FK44 | 2e-73 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
| TrEMBL | A0A0D3B1S3 | 1e-74 | A0A0D3B1S3_BRAOL; Uncharacterized protein | ||||
| STRING | Bo3g013050.1 | 2e-75 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2269 | 27 | 75 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G18270.1 | 8e-76 | Arabidopsis NAC domain containing protein 87 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




