![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_41930.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 68aa MW: 8188.13 Da PI: 4.3441 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 24.1 | 6.3e-08 | 33 | 67 | 6 | 40 |
S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS- CS
Homeobox 6 tftkeqleeLeelFeknrypsaeereeLAkklgLt 40
++t+eq+ Le+ Fe ++++ e++++LAk lgL
Rsa1.0_41930.1_g00001.1 33 NLTHEQVPLLEKSFETENKLEPERKTQLAKMLGLR 67
789******************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 3.89E-6 | 31 | 67 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 4.26E-4 | 33 | 66 | No hit | No description |
| Pfam | PF00046 | 4.4E-5 | 33 | 67 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 5.4E-7 | 34 | 67 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
MNMEESSKRR PFYCSPDDLL YDYDYYDEQT PDNLTHEQVP LLEKSFETEN KLEPERKTQL 60 AKMLGLRP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_41930.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018453925.1 | 8e-43 | PREDICTED: homeobox-leucine zipper protein HAT5-like | ||||
| Swissprot | Q02283 | 1e-18 | HAT5_ARATH; Homeobox-leucine zipper protein HAT5 | ||||
| TrEMBL | A0A087H661 | 2e-24 | A0A087H661_ARAAL; Uncharacterized protein | ||||
| TrEMBL | A0A087H662 | 2e-24 | A0A087H662_ARAAL; Uncharacterized protein | ||||
| STRING | A0A087H661 | 3e-25 | (Arabis alpina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM545 | 28 | 143 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G01470.1 | 3e-20 | homeobox 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




