![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_45292.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 128aa MW: 13962.8 Da PI: 11.0066 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 58.8 | 7.1e-19 | 68 | 102 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++C + kTp+WR gp g+ktLCnaCG+++++ +l
Rsa1.0_45292.1_g00001.1 68 CTHCASDKTPQWRTGPLGPKTLCNACGVRFKSGRL 102
*******************************9885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 2.2E-15 | 62 | 112 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 5.23E-15 | 66 | 126 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 4.6E-14 | 66 | 100 | IPR013088 | Zinc finger, NHR/GATA-type |
| PROSITE profile | PS50114 | 11.187 | 66 | 98 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 1.67E-12 | 67 | 114 | No hit | No description |
| Pfam | PF00320 | 9.4E-17 | 68 | 102 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 68 | 93 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MTSLKTETSK PRSKRSKPPA AFGTWAPMSE PDQNIHVPGR SKPKKEHSGG GGRHQSSAET 60 AEGGLRRCTH CASDKTPQWR TGPLGPKTLC NACGVRFKSG RLVPEYRPAS SPTFVLTQHS 120 NSHRKVME |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_45292.1_g00001.1 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB493590 | 2e-66 | AB493590.1 Arabidopsis thaliana At2g45050 mRNA for hypothetical protein, partial cds, clone: RAAt2g45050. | |||
| GenBank | AK317134 | 2e-66 | AK317134.1 Arabidopsis thaliana AT2G45050 mRNA, complete cds, clone: RAFL21-72-C19. | |||
| GenBank | AY080745 | 2e-66 | AY080745.1 Arabidopsis thaliana At2g45050 mRNA sequence. | |||
| GenBank | BT000921 | 2e-66 | BT000921.1 Arabidopsis thaliana clone C105099 putative GATA-type zinc finger transcription factor (At2g45050) mRNA, complete cds. | |||
| GenBank | CP002685 | 2e-66 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| GenBank | Y13649 | 2e-66 | Y13649.1 Arabidopsis thaliana mRNA for GATA transcription factor 2. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022556119.1 | 3e-78 | GATA transcription factor 2-like isoform X1 | ||||
| Refseq | XP_022556120.1 | 2e-78 | GATA transcription factor 2-like isoform X2 | ||||
| Swissprot | O49741 | 6e-58 | GATA2_ARATH; GATA transcription factor 2 | ||||
| TrEMBL | A0A3P6CRW6 | 2e-76 | A0A3P6CRW6_BRAOL; Uncharacterized protein | ||||
| STRING | Bo4g195320.1 | 7e-77 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3203 | 26 | 66 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45050.1 | 2e-60 | GATA transcription factor 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




