PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_46011.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

Dof

Protein Properties

Length: 97aa MW: 11223.6 Da PI: 10.0936

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_46011.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	129.4	1e-40	31	90	3	62
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 +++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn k+s Rsa1.0_46011.1_g00001.1 31 QEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNAKRS 90 7899****************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF02701	4.0E-34	32	88	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.394	34	88	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	4.0E-26	34	89	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	36	72	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MQDPAAYYQS MMAKQLHQQQ QQQQQPQFPD QEQLKCPRCD SPNTKFCYYN NYNLSQPRHF 60 CKSCRRYWTK GGALRNVPVG GGSRKNAKRS TSSSTSP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_46011.1_g00001.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018486344.1	2e-67	PREDICTED: dof zinc finger protein DOF3.1-like
Swissprot	O82155	2e-45	DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBL	V4LBD4	1e-48	V4LBD4_EUTSA; Uncharacterized protein
STRING	XP_006406292.1	3e-49	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1269	28	96

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G21270.1	4e-43	DOF zinc finger protein 2

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]