PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_50977.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

WOX

Protein Properties

Length: 131aa MW: 15618 Da PI: 9.9685

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_50977.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	58	1.6e-18	1	59	4	57
-SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 4 RttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 R+++t+eql +Lee++ + r+p+a + ++++++l +++ ++V++WFqN++a++++ Rsa1.0_50977.1_g00001.1 1 RWCPTPEQLMILEEMYGSgIRTPNAVQVQQITAHLafygRIEGKNVFYWFQNHKARDRQ 59 9**************99***********************************996 PP
2	Wus_type_Homeobox	114.7	4.6e-37	1	60	5	64
Wus_type_Homeobox 5 RWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 RW+PtpeQ++iLee+y sG+rtPn+ ++q+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk Rsa1.0_50977.1_g00001.1 1 RWCPTPEQLMILEEMYGSGIRTPNAVQVQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 60 9**********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	2.14E-10	1	60	IPR009057	Homeodomain-like
CDD	cd00086	0.00166	1	58	No hit	No description
PROSITE profile	PS50071	10.284	1	60	IPR001356	Homeobox domain
Pfam	PF00046	2.5E-16	1	59	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	9.6E-7	1	59	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 131 aa Download sequence Send to blast
RWCPTPEQLM ILEEMYGSGI RTPNAVQVQQ ITAHLAFYGR IEGKNVFYWF QNHKARDRQK 60 LRKKLAKKLH QQQNHLQLQL QQIKPRPISM MSPPLNNIIE YQNPCHHHHR PYDHMSFACW 120 SQPSPICLSH E

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269\|PubMed:11751640, ECO:0000269\|PubMed:15169755}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_50977.1_g00001.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013744202.1	6e-63	WUSCHEL-related homeobox 3
Swissprot	Q9SIB4	4e-57	WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBL	A0A3P6D2D9	1e-61	A0A3P6D2D9_BRAOL; Uncharacterized protein
STRING	Bo4g165520.1	2e-61	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7480	26	42

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G28610.1	2e-49	WOX family protein

Publications ? help Back to Top
Chandler JW,Werr W Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation. J. Exp. Bot., 2014. 65(12): p. 3097-110 [PMID:24744428] Niu L, et al. LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula. Plant J., 2015. 81(3): p. 480-92 [PMID:25492397] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Guan C, et al. Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086]