![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_51433.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 89aa MW: 10264.8 Da PI: 9.8273 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 64.9 | 1.5e-20 | 20 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd ll+d+v+++G g+W+++ar g++R +k+c++rw +yl
Rsa1.0_51433.1_g00001.1 20 KGPWTAEEDRLLIDYVRLHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 67
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.806 | 15 | 71 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.4E-22 | 19 | 66 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 7.2E-17 | 19 | 69 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.0E-18 | 20 | 67 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.59E-22 | 21 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.95E-12 | 22 | 67 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 9.9E-6 | 67 | 89 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MSLWGAMGGG WGLVEEGWRK GPWTAEEDRL LIDYVRLHGE GRWNSVARLA GLKRNGKSCR 60 LRWVNYLRPD LKRGQITPHE ETIILELHA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 4e-13 | 20 | 88 | 27 | 94 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_51433.1_g00001.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189491 | 1e-138 | AC189491.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB084M06, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010466831.1 | 3e-58 | PREDICTED: transcription factor WER-like | ||||
| Refseq | XP_010488527.1 | 3e-58 | PREDICTED: transcription factor WER-like | ||||
| Refseq | XP_018489634.1 | 3e-58 | PREDICTED: myb-related protein 305-like | ||||
| Swissprot | Q10MB4 | 2e-32 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
| TrEMBL | A0A398A2J5 | 2e-56 | A0A398A2J5_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P5ZPQ1 | 2e-56 | A0A3P5ZPQ1_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4CCL1 | 2e-56 | M4CCL1_BRARP; Uncharacterized protein | ||||
| STRING | XP_010466831.1 | 1e-57 | (Camelina sativa) | ||||
| STRING | XP_010488527.1 | 1e-57 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24310.1 | 4e-51 | myb domain protein 305 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




