![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_54350.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 54aa MW: 6092.76 Da PI: 3.5921 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 36.5 | 1.1e-11 | 11 | 52 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
W ++E+ ll++a+ +G g+Wk + +++g +t +c+++++
Rsa1.0_54350.1_g00001.1 11 DWNADEEILLLEAIVTYGFGNWKEVVNYVG-SKTQAECIDYFN 52
5*****************************.**********98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 8.22E-12 | 4 | 53 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51293 | 17.839 | 7 | 54 | IPR017884 | SANT domain |
| SMART | SM00717 | 0.0015 | 8 | 54 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.7E-9 | 10 | 53 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 5.0E-11 | 11 | 53 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.04E-10 | 12 | 52 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 54 aa Download sequence Send to blast |
DNLSFPLVSC DWNADEEILL LEAIVTYGFG NWKEVVNYVG SKTQAECIDY FNSA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known (By similarity). ADA2 stimulates the acetyltransferase activity of GCN5 on free histones or nucleosomes, probably by opening up the promoter region. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_54350.1_g00001.1 |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018492581.1 | 6e-29 | PREDICTED: transcriptional adapter ADA2a-like | ||||
| Swissprot | Q9SFD5 | 6e-25 | TAD2A_ARATH; Transcriptional adapter ADA2a | ||||
| TrEMBL | A0A078HEX0 | 4e-27 | A0A078HEX0_BRANA; Transcriptional adapter | ||||
| TrEMBL | A0A397ZF29 | 4e-27 | A0A397ZF29_BRACM; Transcriptional adapter | ||||
| TrEMBL | A0A3N6TEK1 | 4e-27 | A0A3N6TEK1_BRACR; Uncharacterized protein | ||||
| TrEMBL | A0A3P5YZ13 | 4e-27 | A0A3P5YZ13_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6FCJ3 | 4e-27 | A0A3P6FCJ3_BRAOL; Uncharacterized protein | ||||
| TrEMBL | M4ELK5 | 4e-27 | M4ELK5_BRARP; Transcriptional adapter | ||||
| STRING | Bra029673.1-P | 6e-28 | (Brassica rapa) | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




