![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_55877.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 104aa MW: 12432.5 Da PI: 9.9865 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 129.6 | 2.3e-40 | 1 | 104 | 4 | 109 |
NAM 4 GfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89
GfrFhPtdeel+v+yL++kve+k+++l e ik++diyk++PwdLp+ + + kewyfF+ r +ky+++ r+nr+t+sg+Wkatg d
Rsa1.0_55877.1_g00001.1 1 GFRFHPTDEELLVYYLRRKVENKPIKL-ELIKQIDIYKFDPWDLPRVSSVGAKEWYFFCMRGRKYKNSVRPNRVTDSGFWKATGID 85
9**************************.99***************77777999********************************* PP
NAM 90 kevlskkgelvglkktLvfy 109
k+v+s + vglkk+Lv+y
Rsa1.0_55877.1_g00001.1 86 KPVYS-NLDCVGLKKSLVYY 104
*****.9999*********9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF02365 | 6.8E-19 | 1 | 104 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 40.536 | 1 | 104 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 6.15E-41 | 1 | 104 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
GFRFHPTDEE LLVYYLRRKV ENKPIKLELI KQIDIYKFDP WDLPRVSSVG AKEWYFFCMR 60 GRKYKNSVRP NRVTDSGFWK ATGIDKPVYS NLDCVGLKKS LVYY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 3e-38 | 1 | 104 | 18 | 121 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_55877.1_g00001.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM975669 | 1e-110 | KM975669.1 Brassica napus NAC transcription factor 42.1 (NAC42.1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018481287.1 | 2e-69 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
| Swissprot | Q9SK55 | 2e-67 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
| TrEMBL | A0A0D3B6F4 | 5e-68 | A0A0D3B6F4_BRAOL; Uncharacterized protein | ||||
| STRING | Bo3g036290.1 | 9e-69 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM306 | 28 | 200 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G43000.1 | 1e-69 | NAC domain containing protein 42 | ||||




