PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_60362.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

MYB_related

Protein Properties

Length: 88aa MW: 10141.5 Da PI: 7.9758

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_60362.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	64.5	2.1e-20	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEdellvd ++++G g+W++ ++ g++R++k+c++rw +yl Rsa1.0_60362.1_g00001.1 14 KGPWTQEEDELLVDHIQKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.7E-28	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.931	9	65	IPR017930	Myb domain
SMART	SM00717	9.3E-16	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.0E-18	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.58E-25	15	88	IPR009057	Homeodomain-like
CDD	cd00167	2.76E-12	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	9.2E-10	65	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	8.999	66	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MGRSPCCDEN GLKKGPWTQE EDELLVDHIQ KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY 60 LRPDIKRGNF TEEEEETIIN LHSLLGNK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-18	12	88	25	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_60362.1_g00001.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC189501	4e-95	AC189501.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB087B10, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006400219.1	6e-58	transcription factor MYB41 isoform X1
Refseq	XP_024011444.1	6e-58	transcription factor MYB41 isoform X1
Refseq	XP_024011445.1	3e-58	transcription factor MYB93 isoform X2
Swissprot	Q9S9Z2	3e-50	MYB93_ARATH; Transcription factor MYB93
TrEMBL	V4LGY1	1e-56	V4LGY1_EUTSA; Uncharacterized protein
STRING	XP_006400219.1	2e-57	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G16770.2	2e-53	myb domain protein 9

Publications ? help Back to Top
Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]