![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_64922.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 46aa MW: 5402.21 Da PI: 7.535 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 37.4 | 7.5e-12 | 11 | 45 | 1 | 36 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevike 36
+ppGfrFhPt+eel+++yL+kk+++ k++l +vi++
Rsa1.0_64922.1_g00001.1 11 VPPGFRFHPTEEELLQYYLRKKISNIKIDL-DVIRD 45
69*************************999.88877 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.75E-12 | 7 | 46 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 15.311 | 11 | 46 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.5E-8 | 12 | 35 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 46 aa Download sequence Send to blast |
MNISVNGQSQ VPPGFRFHPT EEELLQYYLR KKISNIKIDL DVIRDV |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues such as tracheary elements. {ECO:0000269|PubMed:16214898}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_64922.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AL138642 | 2e-49 | AL138642.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F21F14. | |||
| GenBank | CP002686 | 2e-49 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010544875.1 | 7e-25 | PREDICTED: NAC domain-containing protein 43 | ||||
| Swissprot | Q9M274 | 8e-24 | NAC66_ARATH; NAC domain-containing protein 66 | ||||
| TrEMBL | A0A1J3FHU5 | 8e-24 | A0A1J3FHU5_NOCCA; NAC domain-containing protein 43 (Fragment) | ||||
| STRING | XP_010544875.1 | 3e-24 | (Tarenaya hassleriana) | ||||
| STRING | Bo6g066300.1 | 2e-24 | (Brassica oleracea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G61910.1 | 3e-26 | NAC domain protein 66 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




