PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_68451.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

Protein Properties

Length: 92aa MW: 10304.4 Da PI: 4.9276

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_68451.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	33	1.1e-10	2	36	63	98
TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 63 kGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 +GWk+F++angLk+gD++++kl++ +++++v++++ Rsa1.0_68451.1_g00001.1 2 GGWKDFAEANGLKTGDSFTLKLIW-EDTTPVLSLCP 36 7***********************.88889999986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50863	10.701	1	38	IPR003340	B3 DNA binding domain
Gene3D	G3DSA:2.40.330.10	1.7E-8	2	38	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF02362	4.9E-9	2	36	IPR003340	B3 DNA binding domain
CDD	cd10017	1.42E-9	2	36	No hit	No description
SuperFamily	SSF101936	6.28E-10	2	41	IPR015300	DNA-binding pseudobarrel domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
EGGWKDFAEA NGLKTGDSFT LKLIWEDTTP VLSLCPEECS FDSGQGGCSE TIQKKSSPPI 60 ERSNCGKVIK ERNNRENDSK EQTRPMEKEK NH

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_68451.1_g00001.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018433753.1	1e-52	PREDICTED: B3 domain-containing protein REM13-like
Swissprot	P0CAP5	3e-25	REM13_ARATH; B3 domain-containing protein REM13
TrEMBL	V4NJI6	5e-28	V4NJI6_EUTSA; Uncharacterized protein
STRING	XP_006405008.1	8e-29	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7828	16	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G24650.1	1e-27	DNA binding;DNA binding;sequence-specific DNA binding transcription factors

Publications ? help Back to Top
Bindschedler LV,Palmblad M,Cramer R Hydroponic isotope labelling of entire plants (HILEP) for quantitative plant proteomics; an oxidative stress case study. Phytochemistry, 2008. 69(10): p. 1962-72 [PMID:18538804] Mantegazza O, et al. Analysis of the arabidopsis REM gene family predicts functions during flower development. Ann. Bot., 2014. 114(7): p. 1507-15 [PMID:25002525]