![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_68976.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 110aa MW: 12344.1 Da PI: 8.2187 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 145.1 | 2e-45 | 8 | 106 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86
+CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q
Rsa1.0_68976.1_g00001.1 8 PCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQ 93
7************************************************************************************* PP
DUF260 87 leqlkaelallke 99
+++l++el+++++
Rsa1.0_68976.1_g00001.1 94 VHKLQKELDAANA 106
********99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 28.155 | 7 | 108 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 8.1E-45 | 8 | 105 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
STNTYNSPCA ACKFLRRKCM PGCIFAPYFP PEEPHKFANV HKIFGASNVT KLLNELLPHQ 60 REDAVNSLAY EAEARVRDPV YGCVGAISYL QRQVHKLQKE LDAANADLVH |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 5e-65 | 1 | 109 | 4 | 112 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 5e-65 | 1 | 109 | 4 | 112 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_68976.1_g00001.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB008265 | 1e-129 | AB008265.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDC12. | |||
| GenBank | AB164305 | 1e-129 | AB164305.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like gene 4 protein, partial cds. | |||
| GenBank | AB473837 | 1e-129 | AB473837.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like 4 protein, complete cds. | |||
| GenBank | AF447897 | 1e-129 | AF447897.1 Arabidopsis thaliana LOBa (LOB) mRNA, complete cds; alternatively spliced. | |||
| GenBank | BT025745 | 1e-129 | BT025745.1 Arabidopsis thaliana At5g63090 mRNA, complete cds. | |||
| GenBank | CP002688 | 1e-129 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018492348.1 | 3e-78 | PREDICTED: protein LATERAL ORGAN BOUNDARIES isoform X2 | ||||
| Swissprot | Q9FML4 | 5e-77 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A078JVX7 | 1e-75 | A0A078JVX7_BRANA; BnaAnng31240D protein | ||||
| TrEMBL | A0A291LQX1 | 1e-75 | A0A291LQX1_BRARR; Transcription factor LOB | ||||
| TrEMBL | A0A397Z486 | 1e-75 | A0A397Z486_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4FBZ0 | 1e-75 | M4FBZ0_BRARP; Uncharacterized protein | ||||
| STRING | Bra038606.1-P | 2e-76 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 2e-79 | LBD family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




