![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_70461.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 108aa MW: 11995.4 Da PI: 7.2534 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 86.2 | 3e-27 | 58 | 108 | 1 | 52 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEE CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitY 52
++DgynWrKYGqK vkg+ef rsYYrCt+++C++kk++ers +++v+++Y
Rsa1.0_70461.1_g00001.1 58 MEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERSP-GGQIVDTVY 108
58****************************************.9*****999 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 19.118 | 53 | 98 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 5.1E-23 | 54 | 108 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.7E-21 | 54 | 107 | IPR003657 | WRKY domain |
| SMART | SM00774 | 5.2E-25 | 58 | 108 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.4E-20 | 59 | 108 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
EIPESTDSKK LVPASVSEEE EVVVASEKPP KAPESGTVLS LQSGSEGSSS PFIREKVMED 60 GYNWRKYGQK LVKGNEFVRS YYRCTHPNCK AKKQLERSPG GQIVDTVY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-15 | 44 | 98 | 1 | 57 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-15 | 44 | 98 | 1 | 57 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_70461.1_g00001.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189641 | 1e-109 | AC189641.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS008C11, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018491223.1 | 2e-71 | PREDICTED: WRKY transcription factor 1 | ||||
| Swissprot | Q9SI37 | 2e-50 | WRKY1_ARATH; WRKY transcription factor 1 | ||||
| TrEMBL | A0A398A3Y4 | 3e-62 | A0A398A3Y4_BRACM; Uncharacterized protein | ||||
| STRING | Bra013187.1-P | 3e-62 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7949 | 26 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G04880.2 | 6e-38 | zinc-dependent activator protein-1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




