PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_71541.1_g00001.1
Organism
Raphanus sativus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 55aa    MW: 6200.27 Da    PI: 11.1664
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_71541.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA50.85.3e-161446134
                CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeks 34
                             +ep+YVNaKQy++Il+RR++Rak+e e+k  +++
  Rsa1.0_71541.1_g00001.1 14 QEPVYVNAKQYKGILRRRKARAKAELERKA-TNG 46
                             79***************************8.443 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005210.00711254IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115217.6951355IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.5E-121544IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068601838IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
MPGERTALPL DVTQEPVYVN AKQYKGILRR RKARAKAELE RKATNGKVGN LKHVV
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_71541.1_g00001.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7876771e-35KC787677.1 Brassica napus transcription factor subunit NF-YA1A (NF-YA1A) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018476840.17e-25PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_018476841.17e-25PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
SwissprotQ9LXV58e-19NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A0D3B0V31e-19A0A0D3B0V3_BRAOL; Uncharacterized protein
STRINGBo3g008860.12e-20(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.41e-10nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Siriwardana CL, et al.
    NUCLEAR FACTOR Y, Subunit A (NF-YA) Proteins Positively Regulate Flowering and Act Through FLOWERING LOCUS T.
    PLoS Genet., 2016. 12(12): p. e1006496
    [PMID:27977687]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]