![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Rsa1.0_74785.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 102aa MW: 11203.7 Da PI: 7.2581 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 82.1 | 1.5e-25 | 1 | 65 | 9 | 73 |
TCP 9 skihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
sk++T +g+RdRR+Rlsa++a++++dLqd+LG+ ++sk i+WLlq+a+ + l+ +++++ +
Rsa1.0_74785.1_g00001.1 1 SKVCTVRGLRDRRIRLSATTAIQLYDLQDRLGLSQPSKVIDWLLQAAQNDVAMLPPLQFPPGFHL 65
8*******************************************************988877444 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03634 | 3.3E-23 | 1 | 58 | IPR005333 | Transcription factor, TCP |
| PROSITE profile | PS51369 | 24.446 | 1 | 54 | IPR017887 | Transcription factor TCP subgroup |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
SKVCTVRGLR DRRIRLSATT AIQLYDLQDR LGLSQPSKVI DWLLQAAQND VAMLPPLQFP 60 PGFHLNLPTA AAAVGESFPG IFESFDIGSC SSRTDQTTQR ET |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zkt_A | 3e-18 | 1 | 55 | 1 | 55 | Putative transcription factor PCF6 |
| 5zkt_B | 3e-18 | 1 | 55 | 1 | 55 | Putative transcription factor PCF6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Rsa1.0_74785.1_g00001.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC241004 | 1e-110 | AC241004.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026J02, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018475137.1 | 7e-65 | PREDICTED: transcription factor TCP17 | ||||
| Refseq | XP_018475138.1 | 7e-65 | PREDICTED: transcription factor TCP17 | ||||
| Swissprot | Q9LEZ9 | 9e-40 | TCP17_ARATH; Transcription factor TCP17 | ||||
| TrEMBL | A0A3P6A0R2 | 4e-59 | A0A3P6A0R2_BRACM; Uncharacterized protein | ||||
| STRING | Bo3g004670.1 | 8e-57 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3576 | 27 | 63 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G08070.1 | 4e-42 | TCP domain protein 17 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




