![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SMil_00001910-RA_Salv | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10258.8 Da PI: 11.2338 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.5 | 5.6e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W++eEd++l v+++G ++W++ ++ g+ R++k+c++rw +yl
SMil_00001910-RA_Salv 14 KGAWSKEEDDRLRAQVERFGHNNWRRLPSLAGLARCGKSCRLRWMNYL 61
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 7.1E-22 | 8 | 70 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.013 | 9 | 65 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 4.99E-18 | 9 | 70 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.0E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.1E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 6.57E-10 | 16 | 61 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MVRAPTFDSN GIKKGAWSKE EDDRLRAQVE RFGHNNWRRL PSLAGLARCG KSCRLRWMNY 60 LKPGLKRGKF DLKLKRNTSS NYMINSET |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression. Necessary for plant survival in alkaline soil where iron availability is greatly restricted. Triggers tolerance to nickel (Ni) and zinc (Zn) ions. {ECO:0000269|PubMed:24278034}. | |||||
| UniProt | Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Accumulates strongly in the root stele and in the outer layers of the lateral roots when exposed to iron (Fe)-deficient conditions (PubMed:24278034). Slightly induced by ethylene and by darkness conditions (PubMed:9839469). Accumulates upon potassium (K) depletion (PubMed:15489280). Induced by zinc (Zn) and cadmium (Cd) ions (PubMed:18088336). {ECO:0000269|PubMed:15489280, ECO:0000269|PubMed:18088336, ECO:0000269|PubMed:24278034, ECO:0000269|PubMed:9839469}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF059456 | 1e-138 | KF059456.1 Salvia miltiorrhiza MYB-related transcription factor (MYB102) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011100426.1 | 1e-35 | myb-related protein 308-like | ||||
| Refseq | XP_015571043.1 | 8e-36 | transcription factor MYB4-like | ||||
| Swissprot | Q9LTV4 | 2e-26 | MYB10_ARATH; Transcription factor MYB10 | ||||
| Swissprot | Q9LXF1 | 4e-26 | MYB16_ARATH; Transcription factor MYB16 | ||||
| TrEMBL | A0A059PRV4 | 5e-44 | A0A059PRV4_SALMI; MYB-related transcription factor (Fragment) | ||||
| STRING | Migut.M00366.1.p | 4e-33 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12 | 24 | 2154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G12820.1 | 1e-28 | myb domain protein 10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




