![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SMil_00001912-RA_Salv | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 68aa MW: 7457.34 Da PI: 10.9764 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 28.9 | 2.6e-09 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
rg+W++eEd++l v ++G ++W++ + g
SMil_00001912-RA_Salv 14 RGAWSKEEDDRLRAFVSEFGHNNWRLLPLLAG 45
89***********************9887776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 9.63 | 9 | 68 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 6.43E-8 | 9 | 43 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.1E-10 | 12 | 46 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 3.7E-7 | 14 | 45 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.55E-6 | 16 | 46 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
MVKPPTFDSN GMKRGAWSKE EDDRLRAFVS EFGHNNWRLL PLLAGGPPSL GSSPGEPTTR 60 SRTTGTRT |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF059543 | 1e-69 | KF059543.1 Salvia miltiorrhiza MYB-related transcription factor (MYB79) gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012852362.1 | 7e-17 | PREDICTED: transcription factor MYB34-like | ||||
| TrEMBL | A0A059PRF3 | 7e-24 | A0A059PRF3_SALMI; MYB-related transcription factor | ||||
| TrEMBL | A0A075BMG0 | 7e-24 | A0A075BMG0_SALMI; MYB-related transcription factor | ||||
| TrEMBL | W8SLK8 | 6e-24 | W8SLK8_SALMI; Transcription factor mybp | ||||
| STRING | Migut.M00366.1.p | 3e-16 | (Erythranthe guttata) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G79180.1 | 2e-08 | myb domain protein 63 | ||||




