![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SMil_00003669-RA_Salv | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 89aa MW: 10942.5 Da PI: 9.6799 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 23.4 | 1.4e-07 | 29 | 69 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
++T +E++++ + +k+ G + W +Ia +++ gR ++++ +w+
SMil_00003669-RA_Salv 29 NMTDQEEDIINRMHKLVGDR-WGLIAGRLP-GRKAEEIERFWL 69
689***************99.*********.***********7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 1.6E-5 | 26 | 74 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.9E-6 | 29 | 70 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.55E-4 | 29 | 70 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.6E-10 | 30 | 69 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 8.79E-7 | 31 | 70 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010091 | Biological Process | trichome branching | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MDKCRQKQIK IRKYPLCEEV SSIEWEFVNM TDQEEDIINR MHKLVGDRWG LIAGRLPGRK 60 AEEIERFWLM RNSDNFTDKR KEYHRRQKS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020553647.1 | 2e-38 | MYB-like transcription factor ETC3 | ||||
| Swissprot | Q8GV05 | 2e-33 | TRY_ARATH; Transcription factor TRY | ||||
| TrEMBL | A0A4D9ATA4 | 4e-53 | A0A4D9ATA4_SALSN; Myb proto-oncogene protein, plant | ||||
| STRING | XP_006491245.1 | 1e-33 | (Citrus sinensis) | ||||
| STRING | XP_006444875.1 | 1e-33 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA11707 | 18 | 24 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53200.1 | 1e-35 | MYB_related family protein | ||||




