PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00005059-RA_Salv

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

NF-YB

Protein Properties

Length: 137aa MW: 15169 Da PI: 9.834

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00005059-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	106.1	2.3e-33	1	94	1	94
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +++q+r++ ianvsrimkk lP na isk + + + + asdkcqrekrktingddllwa++tlGf++yv+plk yl+ y SMil_00005059-RA_Salv 1 MKDQERVVAIANVSRIMKKSLPPNANISKGSERNSAGMRVGVHKLRDGGASDKCQREKRKTINGDDLLWAMTTLGFQNYVDPLKDYLTTY 90 589**************************999999999999999****************************************** PP NF-YB 91 rele 94 r++ SMil_00005059-RA_Salv 91 RDTS 94 *975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.5E-26	2	95	IPR009072	Histone-fold
SuperFamily	SSF47113	1.49E-18	5	93	IPR009072	Histone-fold
Pfam	PF00808	2.4E-4	50	71	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	8.6E-9	54	72	No hit	No description
PRINTS	PR00615	8.6E-9	73	91	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
MKDQERVVAI ANVSRIMKKS LPPNANISKG SERNSAGMRV GVHKLRDGGA SDKCQREKRK 60 TINGDDLLWA MTTLGFQNYV DPLKDYLTTY RDTSSPIHDK TKIATANPSF LQGFTSDAGG 120 VVIEFATSSW CXHFINL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	5e-27	1	92	1	92	Transcription factor HapC (Eurofung)
4g92_B	5e-27	1	92	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021887454.1	3e-34	nuclear transcription factor Y subunit B-1-like
Swissprot	O23310	3e-32	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
Swissprot	Q75IZ7	6e-32	NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A4D9AZ56	6e-34	A0A4D9AZ56_SALSN; Uncharacterized protein
STRING	evm.model.supercontig_196.1	1e-33	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	1e-34	nuclear factor Y, subunit B3

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]