![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SMil_00006196-RA_Salv | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 108aa MW: 11623.2 Da PI: 8.4891 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 117.8 | 6.5e-37 | 15 | 91 | 1 | 77 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGav 77
+CaaCk+lrr+C ++C++a yfpae+p kf nvhk+FGasnv+kll+++p+++red+++sl+yeAear++dPvyG+v
SMil_00006196-RA_Salv 15 PCAACKFLRRRCLSGCIFAAYFPAEEPTKFVNVHKIFGASNVSKLLNEIPPHQREDTVKSLAYEAEARLKDPVYGCV 91
7***************************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 22.29 | 14 | 108 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 3.1E-36 | 15 | 91 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
MASSSSSSSS YSSPPCAACK FLRRRCLSGC IFAAYFPAEE PTKFVNVHKI FGASNVSKLL 60 NEIPPHQRED TVKSLAYEAE ARLKDPVYGC VWGPSPFLTP GLHPSAGA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 8e-45 | 15 | 91 | 11 | 87 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 8e-45 | 15 | 91 | 11 | 87 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KR076528 | 2e-45 | KR076528.1 Boehmeria nivea lateral organ boundaries domain protein (LBD2) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009597524.1 | 9e-50 | PREDICTED: LOB domain-containing protein 25-like isoform X1 | ||||
| Refseq | XP_011097516.1 | 6e-50 | LOB domain-containing protein 25-like | ||||
| Refseq | XP_016505823.1 | 9e-50 | PREDICTED: LOB domain-containing protein 25-like | ||||
| Refseq | XP_018625398.1 | 9e-50 | PREDICTED: LOB domain-containing protein 25-like isoform X1 | ||||
| Refseq | XP_018625399.1 | 9e-50 | PREDICTED: LOB domain-containing protein 25-like isoform X1 | ||||
| Swissprot | Q9FML4 | 4e-45 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A1S4CXF4 | 2e-48 | A0A1S4CXF4_TOBAC; LOB domain-containing protein 25-like | ||||
| STRING | XP_009597524.1 | 4e-49 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA43 | 24 | 669 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27650.1 | 1e-44 | LOB domain-containing protein 25 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




