PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00006207-RA_Salv

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

MYB

Protein Properties

Length: 90aa MW: 10922.6 Da PI: 10.3853

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00006207-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.2	2.9e-16	3	43	7	48
HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + d++l ++v+++ g++Wk+I+++m+ gRt+ qc +rwqk+l SMil_00006207-RA_Salv 3 WQDKRLTEVVQRFNGKNWKKISECMP-GRTDVQCLHRWQKVL 43 78**********************.***********86 PP
2	Myb_DNA-binding	48.4	2.1e-15	49	90	1	43
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 + +WT+eEd++ ++ v+++G++ W+ Ia+ + gR +kqc++r SMil_00006207-RA_Salv 49 KSPWTKEEDDRVIEFVEKYGSKKWSFIAKFVH-GRNGKQCRER 90 679***************************.******97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.764	1	43	IPR017930	Myb domain
Pfam	PF00249	3.0E-13	3	43	IPR001005	SANT/Myb domain
SMART	SM00717	3.1E-5	3	45	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-19	4	50	IPR009057	Homeodomain-like
CDD	cd00167	2.79E-8	5	43	No hit	No description
SuperFamily	SSF46689	4.77E-24	26	90	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.188	44	90	IPR017930	Myb domain
SMART	SM00717	5.5E-6	48	90	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-14	49	90	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.5E-21	51	90	IPR009057	Homeodomain-like
CDD	cd00167	9.08E-11	51	90	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MLWQDKRLTE VVQRFNGKNW KKISECMPGR TDVQCLHRWQ KVLNPDLIKS PWTKEEDDRV 60 IEFVEKYGSK KWSFIAKFVH GRNGKQCRER

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h88_C	4e-34	4	90	13	142	MYB PROTO-ONCOGENE PROTEIN
1h89_C	4e-34	4	90	13	142	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269\|PubMed:17293435, ECO:0000269\|PubMed:19279197}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269\|PubMed:17293435}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020550693.1	3e-44	uncharacterized protein LOC105164125
Swissprot	Q0JHU7	6e-37	MB3R2_ORYSJ; Transcription factor MYB3R-2
TrEMBL	A0A4D8Y9Z8	2e-50	A0A4D8Y9Z8_SALSN; Uncharacterized protein
STRING	XP_009761862.1	6e-41	(Nicotiana sylvestris)
STRING	XP_009606734.1	7e-41	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA19350	3	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G32730.2	2e-39	Homeodomain-like protein

Publications ? help Back to Top
Kakar KU, et al. A consortium of rhizobacterial strains and biochemical growth elicitors improve cold and drought stress tolerance in rice (Oryza sativa L.). Plant Biol (Stuttg), 2016. 18(3): p. 471-83 [PMID:26681628]