PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00012266-RA_Salv

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

NF-YB

Protein Properties

Length: 130aa MW: 14491.4 Da PI: 4.923

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00012266-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	168.4	8.7e-53	1	93	1	93
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +++q+r++Pianvsrimkk lP nakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGf++yveplk yl+ y SMil_00012266-RA_Salv 1 MKDQERVVPIANVSRIMKKSLPPNAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFQNYVEPLKDYLTTY 90 589*************************************************************************************** PP NF-YB 91 rel 93 r++ SMil_00012266-RA_Salv 91 RDT 93 *97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.7E-48	2	95	IPR009072	Histone-fold
SuperFamily	SSF47113	3.57E-36	4	97	IPR009072	Histone-fold
Pfam	PF00808	5.4E-27	8	71	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.8E-19	35	53	No hit	No description
PROSITE pattern	PS00685	0	38	54	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.8E-19	54	72	No hit	No description
PRINTS	PR00615	1.8E-19	73	91	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MKDQERVVPI ANVSRIMKKS LPPNAKISKE AKETVQECVS EFISFVTGEA SDKCQREKRK 60 TINGDDLLWA MTTLGFQNYV EPLKDYLTTY RDTSPIDDQT KIATANPSFL QGFSSDGGGV 120 VIEFATSSWC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-45	1	92	1	92	Transcription factor HapC (Eurofung)
4g92_B	1e-45	1	92	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021887454.1	5e-56	nuclear transcription factor Y subunit B-1-like
Swissprot	O23310	5e-53	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A2P6RRA0	7e-53	A0A2P6RRA0_ROSCH; Putative transcription factor Hap3/NF-YB family
TrEMBL	A0A314Y796	1e-52	A0A314Y796_PRUYE; Nuclear transcription factor Y subunit B-8
TrEMBL	A0A4D9AZ56	3e-53	A0A4D9AZ56_SALSN; Uncharacterized protein
STRING	evm.model.supercontig_196.1	2e-55	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	2e-55	nuclear factor Y, subunit B3

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]