PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00014720-RA_Salv

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

M-type_MADS

Protein Properties

Length: 74aa MW: 8534.03 Da PI: 10.5381

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00014720-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	103.6	7.1e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s SMil_00014720-RA_Salv 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.515	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	9.16E-32	2	67	IPR002100	Transcription factor, MADS-box
CDD	cd00265	8.84E-39	2	65	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.4E-34	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.4E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.4E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 74 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS 60 SREKLSDLAR CVIQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	5e-21	1	65	1	65	MEF2C
5f28_B	5e-21	1	65	1	65	MEF2C
5f28_C	5e-21	1	65	1	65	MEF2C
5f28_D	5e-21	1	65	1	65	MEF2C
6byy_A	4e-21	1	65	1	65	MEF2 CHIMERA
6byy_B	4e-21	1	65	1	65	MEF2 CHIMERA
6byy_C	4e-21	1	65	1	65	MEF2 CHIMERA
6byy_D	4e-21	1	65	1	65	MEF2 CHIMERA
6bz1_A	4e-21	1	65	1	65	MEF2 CHIMERA
6bz1_B	4e-21	1	65	1	65	MEF2 CHIMERA
6bz1_C	4e-21	1	65	1	65	MEF2 CHIMERA
6bz1_D	4e-21	1	65	1	65	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	X95469	8e-68	X95469.1 A.majus mRNA for MADS-box protein (DEFH200).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021997166.1	3e-37	agamous-like MADS-box protein AGL9 homolog isoform X6
Refseq	XP_027099546.1	4e-37	agamous-like MADS-box protein AGL9 homolog isoform X1
Refseq	XP_027099548.1	4e-37	agamous-like MADS-box protein AGL9 homolog isoform X3
Refseq	XP_027154053.1	4e-37	agamous-like MADS-box protein AGL9 homolog isoform X1
Swissprot	Q03489	5e-37	AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBL	A0A022QXX8	1e-36	A0A022QXX8_ERYGU; Uncharacterized protein (Fragment)
TrEMBL	A0A438DXH4	1e-36	A0A438DXH4_VITVI; Agamous-like MADS-box protein AGL9-like
STRING	POPTR_0003s16800.1	4e-37	(Populus trichocarpa)
STRING	Lus10011349	4e-37	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	4e-39	MIKC_MADS family protein

Publications ? help Back to Top
Immink RG,Gadella TW,Ferrario S,Busscher M,Angenent GC Analysis of MADS box protein-protein interactions in living plant cells. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(4): p. 2416-21 [PMID:11854533] Immink RG, et al. Analysis of the petunia MADS-box transcription factor family. Mol. Genet. Genomics, 2003. 268(5): p. 598-606 [PMID:12589434] Angenent GC,Busscher M,Franken J,Mol JN,van Tunen AJ Differential expression of two MADS box genes in wild-type and mutant petunia flowers. Plant Cell, 1992. 4(8): p. 983-93 [PMID:1356537] Tonaco IA,Borst JW,de Vries SC,Angenent GC,Immink RG In vivo imaging of MADS-box transcription factor interactions. J. Exp. Bot., 2006. 57(1): p. 33-42 [PMID:16291798]